Segment TRYP

Consensus Sequence

FPTDDDDKIVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKFVIEVRLGEHNIDVLEGNEQFINAAKIITHPNFDGNTLDNDIMLIKLSSPATLNSRVATVSLPRSCAAAGTECLISGWGNTKSSGSSYPSLLQCLKAPVLSDSSCKSSYPGQITNGMICVGFLEGGKDSCQGDSGGPVVCDGQLQGIVSWGYGPGMKNKPGVYTKVCNYVNWVQQTIAAN

Annotated Consensus Sequence

ConsensusTemplate

FSF

VRV

EQE

DND

NGGNNG

DND

PCP

GAG

MQM

VIV

Sequence Consensus Overview

MLGN

VMGA

ASY

NGT

DQPC

YSTVA

QYA

VLDN

TSGS

DGA

GTS

WLV

DFETS

PHA

TFA

SNHGC

MQEGNAY

LGSHRDK

CLYAHF

LDRSPV

SHLQL

TELNA

PGVA

DSLGGR

GNG

LNA

FSTDLN

TDF

GGGND

DGGN

LRNSN

SRSA

KRA

TSL

PCS

RAL

LAR

TSC

MAMGW

TSGGNSQ

ASTA

AMGRWSC

TAMPRL

DRKHVYA

ASV

LSD

VSCS

PSK

ANG

CAM

AGN

AGA

GQG

QGQ

TKT

AKA

DTC

RAN

0
1
2
3
4
5
6
7
8	L	1	1.3329333333333333
9	V	1	2.2579933333333333
10	S	1	0	M	1	0.41965	L	1	0.9165	G	1	1	N	2	0.16501333333333332
11	V	1	0.33254	M	1	0.38069	G	1	0.99827
12	A	1	0.29	S	1	0.91875	Y	1	1.4133200000000001
13	Q	1	0.11707333333333332	N	1	0.32924	G	1	0.58564	T	1	1.85176
14	D	1	0.11844	Q	1	0.17311	P	1	0.5875266666666666	C	1	1.071185
15	Y	1	0.33241	S	1	0.56984	T	1	0.9164	V	1	0.98965	A	1	1.8437999999999999
16	Q	1	1.16773	Y	1	1.18852	A	1	1.999765
17	V	1	0.32939	L	1	0.52766	D	1	1.72672	N	1	2.0505416666666667
18		1	0	S	1	10.265394841269842	TV	2	0.47499099999999994
19		1	0	V	1	4.208024444444445	L	1	4.4332609523809525
20	P	1	11.057160365079366
21	Y	1	10.168320730158731
22	G	1	0.3957125	Q	1	11.145353112933849
23	V	1	13.119575350117719
24	S	1	14.080927551644264
25	L	1	14.309443441140731
26	D	1	3.588409090909091	N	1	10.72188115538847
27	D	1	0.47663	T	1	0.6753125000000001	S	1	11.230458577694238	GS	2	0.73477
28	N	1	0.40854	D	1	0.95226	G	1	11.822295299327866
29		1	0	R	1	0.15265	F	1	0.22623333333333331	G	1	1	T	1	3.987919090909091	S	1	12.574581315789473	HS	2	0
30	N	1	0.35937	V	1	0.38521	Q	1	0.92773	H	1	24.384244769822285
31		1	0	G	1	0	W	1	0.03429	S	1	0.8915	F	1	25.92612443893826
32	F	1	0		1	0	Q	1	0.70087	S	1	1	C	1	29.963281563473625
33	C	1	1	G	1	28.76398063387706	N	2	5.492248909090909
34		1	0	G	1	25.61372987623217
35	T	1	0.74372	S	1	36.91120455184949
36	N	1	0.80179	L	1	38.14502691633455
37	Q	1	1	L	1	35.73207962001219
38	D	1	0.99668	N	1	35.636844455426676
39	N	1	0.90533	E	1	16.77880601219937	S	1	20.757556911764706
40	M	1	0.6	L	1	0.99009	D	1	1.4985925	N	1	15.001572011001484	Q	1	19.197589558823527
41	D	1	0.74707	M	1	0.98189	MA	1	1.0655000000000001	G	1	1.99234	W	1	32.51573773720912
42	S	1	0.89106	V	1	17.346855559540888
43	W	1	0.94515	L	1	0.99214	V	1	16.571890288737446
44		1	0	D	1	0.94277	F	1	0.94456	E	1	0.99287	T	1	4.341941922525107	S	1	9.74201
45	R	1	0.39504	P	1	0.86986	H	1	2.297218170731707	A	1	12.56058875
46	N	1	0.41372	T	1	0.88453	F	1	1.3228675609756098	A	1	11.63619625
47	T	1	0.49882	C	1	0.99973	H	1	11.391438749999999
48	F	1	0.36359	M	1	0.39411	S	1	0.64814	N	1	1.2235	H	1	1.56753	G	1	1.62479	C	1	2.74583625
49	W	1	0.0422	H	1	0.29583	M	1	0.62554	Q	1	0.68143	E	1	0.75714	G	1	0.78492	N	1	0.80267	A	1	1	Y	1	1.4785975
50	L	1	0.47662	G	1	0.71242	S	1	0.9729	H	1	0.99654	R	1	1.19479	D	1	1.37594	K	1	1.95543
51	D	1	0.12889	C	1	0.22177	L	1	0.48579	Y	1	0.6043000000000001	A	1	0.87838	H	1	0.99752	F	1	1
52	A	1	0.1238	L	1	0.28195	D	1	0.56592	R	1	0.65477	S	1	0.95183	P	1	1	V	1	1.15774
53	S	1	0.39812	H	1	1	L	1	1.66175	QL	2	1
54	T	1	0.81738	E	1	1.88787	LN	2	0.7285200000000001
55		1	0	P	1	0.97656	G	1	0.98402	V	1	5.56676
56		1	0	P	1	0	M	1	0.32451	F	1	0.36707	N	1	0.41034	D	1	0.69092	S	1	0.86489	LG	1	0.9037999999999999	G	1	0.90726	R	1	5.69782
57		1	0	V	1	0.69697	N	1	1.1481700000000001	P	1	1.3242	A	1	1.5747	D	1	1.8758499999999998	L	1	170.37071503665973	GL	2	2.724235	VA	2	3.76671	AV	2	5.850315
58		1	0	M	1	0.19001	S	1	0.76644	K	1	0.86856	R	1	0.9515800000000001	E	1	1.13299	Q	1	1.5245799999999998	F	1	1.9356	D	1	4.329856666666666	A	1	5.0852699999999995	P	1	5.3497	L	1	5.41271	N	1	6.651292499999999	V	1	8.17526236394558	G	1	161.61853980246124	EG	2	1.0780746666666667
59		1	0	T	1	0.22681	A	1	0.3008	S	1	0.66056	N	1	1.16549	V	1	1.3222	P	1	1.6537899999999999	Y	1	2.184594	D	1	2.505874	F	1	3.411718181818182	Q	1	4.73303	G	1	9.656917857142856	L	1	9.997650000000002	H	1	12.865023333333333	E	1	159.18112370537406	HE	2	5.392325	NEH	3	0.47050666666666663	HNE	3	5.073224722222223
60		1	0	K	1	0.37849	V	1	0.47064	G	1	0.77	D	1	0.93515	F	1	0.95986	A	1	1.15008	N	1	4.11058	E	1	4.172268181818182	L	1	4.626106666666667	Q	1	9.705373333333334	H	1	261.3626484468378
61		1	0	F	1	0.20636	GG	1	0.55342	M	1	0.63355	V	1	1.4287	E	1	4.421561428571429	A	1	6.389749999999999	H	1	7.452070000000001	Q	1	7.716292000000001	D	1	24.173084166666666	N	1	257.873731870353
62		1	0	G	1	0.06976	P	1	0.77026	E	1	2.5028500000000005	L	1	401.85174585688236	DL	2	14.283360773809521
63		1	0	N	1	1.77157	L	1	1.8023	E	1	44.50713370408163	D	1	311.0773952618128
64		1	0	G	1	0.14296	E	1	0.9772	P	1	0.98913	V	1	434.8407565134853
65	Q	1	0	K	1	0.059421999999999996	T	1	0.86403	E	1	1.81398	V	1	3.27313	N	1	8.627685	L	1	410.2511032542351
66	S	1	0.18813	Q	1	0.19204	M	1	0.27479	V	1	0.99977	G	1	1	A	1	1.22464	T	1	2.54217	D	1	2.8901144444444444	H	1	4.6337	N	1	13.866477999999997	E	1	379.4027503913214	GE	2	1.254775	GNE	3	0.6685933333333334
67		1	0	M	1	0.06834	C	1	1	T	1	2.4103401090909093	V	1	2.7135966666666667	P	1	2.74678	Q	1	3.49767	D	1	5.4779744444444445	S	1	5.935993333333333	H	1	6.408310714285714	N	1	7.283567499999999	A	1	8.211383333333332	E	1	11.823159999999998	G	1	268.663224542574	NG	2	58.16159504761902	EGN	3	0.6193
68	E	1	0	P	1	0.22785333333333332	V	1	0.28342	M	1	0.65856	T	1	1.27471	A	1	1.50782	GG	1	2.7732216666666663	Q	1	3.666983333333333	G	1	6.328290000000001	S	1	6.34653	D	1	7.861986	H	1	9.472150000000001	L	1	30.39240298535353	N	1	192.60524184298527	QD	2	0.37961	DQ	2	2.2771	QNE	3	0.38616333333333336
69		1	0	W	1	0.16891	Y	1	0.48909	A	1	0.51011	M	1	0.9039400000000001	G	1	1.5675666666666666	L	1	2.99883	Q	1	3.77905238095238	N	1	4.6951833333333335	H	1	6.955613333333334	D	1	7.100056666666667	S	1	8.320217333333334	V	1	38.076051675613265	E	1	246.67659110689445	QE	2	0.9319149999999999
70		1	0	C	1	0.31816	K	1	0.72925	L	1	0.94118	G	1	0.97487	F	1	1	H	1	1.1045333333333334	V	1	1.18797	E	1	3.0970566666666666	M	1	4.59688	GA	1	4.7202649999999995	N	1	4.855286666666667	D	1	36.12102397366522	Q	1	318.9552561029256
71		1	0	E	1	0.12895	S	1	0.53865	K	1	0.57066	H	1	0.57829	T	1	0.8798	D	1	0.99977	Y	1	0.99996	N	1	1.95133	M	1	7.420391904761906	L	1	10.32685605151515	F	1	388.9217004322213
72	R	1	0.89444	F	1	0.90776	N	1	1	D	1	1.63338	G	1	1.7170100000000001	M	1	2.182041890909091	L	1	361.9684665117622
73	Q	1	0.00952	V	1	1.64929	E	1	1.96367	L	1	2.8064299999999998	R	1	2.8461299999999996	G	1	2.9978	D	1	5.578192666666666	GG	1	7.184093125	N	1	325.0032006933262	AN	2	0.77744	GQ	2	5.87051
74		1	0	P	1	0.70745	D	1	0.72311	R	1	0.99942	M	1	1	S	1	1.09165	E	1	1.27096	V	1	1.5402666666666667	Q	1	1.9963600000000001	L	1	2.41634	K	1	8.186623333333333	G	1	12.697363999999999	A	1	311.128524354937
75		1	0	N	1	0.06565	E	1	0.16955	D	1	0.9029	P	1	0.93465	F	1	0.99992	Q	1	1.52289	R	1	1.6221900000000002	L	1	2.37785	G	1	2.70441	K	1	7.009582888888888	V	1	9.101804952380952	A	1	301.1369359964831	KA	2	5.614477
76		1	0	T	1	0.0334	Q	1	0.32655	GL	1	0.36188125000000004	G	1	0.41859833333333335	Y	1	0.43044	A	1	0.5599233333333333	E	1	1.75019	H	1	2.14567	R	1	2.9921000000000006	V	1	4.860460666666667	K	1	269.16280742700206
77		1	0	A	1	0.24503	P	1	0.859	E	1	0.96574	G	1	1.0921877777777778	L	1	131.0841025487363
78		1	0	F	1	0.0963	Y	1	0.19960666666666665	R	1	0.71246	D	1	0.96064	V	1	1.42549	A	1	3.57721	G	1	4.23175	T	1	5.0093375	L	1	152.61672903765094
79		1	0	R	1	0	F	1	0.04789	Y	1	0.16888	N	1	0.46058875	S	1	0.56819	D	1	0.99157	Q	1	1	E	1	1.00301	P	1	1.7120799999999998	A	1	3.14486	H	1	3.690455	L	1	4.014959999999999	V	1	4.3146	T	1	120.39847939947185	HT	2	2.4222400000000004
80		1	0	A	1	0.04516	D	1	0.83393	R	1	0.95352	P	1	0.95768	N	1	1.23999	G	1	1.33026	L	1	2.6465899999999998	H	1	148.71630365435294
81		1	0	V	1	0.30539	S	1	1.01792	M	1	1.51695	H	1	4.862430000000001	T	1	4.987386666666667	G	1	6.898689999999999	L	1	18.13159641269841	P	1	111.6249059235472	NFP	3	0.7168199999999999
82	V	1	0		1	0	H	1	0.52714	A	1	0.58236	M	1	0.5963849999999999	Y	1	0.96163	P	1	0.98878	E	1	1.343658	GG	1	4.14706	G	1	4.718569166666667	F	1	5.765610000000001	S	1	6.46513	T	1	11.290740000000001	D	1	13.762883841269838	L	1	18.197059999999997	N	1	38.435953039197635	FN	2	0.8768450000000001
83		1	0	Y	1	0.09837	Q	1	0.12467	P	1	0.20115	R	1	0.2913	W	1	0.34097	H	1	0.64109	S	1	1.8503700000000003	E	1	2.8315400000000004	L	1	3.656604999999999	N	1	6.035747761904762	G	1	6.0901008333333335	T	1	7.02872	D	1	19.255225	F	1	75.31879371519231
84		1	0	E	1	0.04457	H	1	0.15387	F	1	0.40289	T	1	0.82541	S	1	0.9412	P	1	0.99966	Q	1	1	L	1	1.19827	G	1	8.04518	GG	1	8.501982916666666	N	1	50.973905566253045	D	1	75.59862480952381	GN	2	0.765305
85		1	0	E	1	0.32036000000000003	N	1	0.45985	L	1	0.46472	Q	1	0.5312	F	1	0.66394	S	1	1.5777133333333333	H	1	1.7206100000000002	M	1	3.928404444444445	T	1	4.68169	D	1	26.802086666666664	G	1	136.41433637844426	NG	2	1.551975
86		1	0	C	1	0.45912	T	1	0.62663	S	1	1.2867466666666667	Q	1	1.2904399999999998	G	1	1.5024899999999999	E	1	1.9979	M	1	2.10249	L	1	4.293853333333334	D	1	9.968143333333334	GG	1	30.892654188492063	N	1	92.44958348095338	SQ	2	0	TN	2	0.45199999999999996
87	N	1	0.1459	K	1	0.16827	S	1	0.94352	L	1	1	F	1	1.6717099999999998	D	1	1.88625	T	1	218.77123675656512
88	E	1	0.04579	V	1	0.1912	M	1	0.51779	N	1	1	F	1	2.5244400000000002	L	1	219.45934120228668
89	G	1	0.98775	M	1	1	N	1	2.478485	D	1	214.3733469335509	ND	2	2.2009533333333335
90		1	0	E	1	0.91445	S	1	1.09335	GG	1	3.22992	D	1	36.39171017041479	N	1	168.68790051144117	DN	2	3.929495
91	E	1	0.37566999999999995	S	1	0.97781	H	1	0.99886	T	1	1.61785	N	1	1.80742	D	1	200.36061326504574	EV	2	0.310805	VE	2	1	LD	2	1.8171849999999998
92	N	1	0.11429	T	1	0.2117	M	1	0.88725	D	1	0.94077	P	1	2.8864900000000002	L	1	235.54733052614026
93		1	0	L	1	0.54881	P	1	0.98087	V	1	1.2784	S	1	1.3837599999999999	R	1	1.59471	T	1	4.475428636363636	M	1	230.9231342259919	LM	2	1.89831
94		1	0	K	1	0.31163	W	1	0.3744	V	1	0.62848	L	1	231.4663452920188
95		1	0	G	1	0.68587	T	1	0.87853	S	1	0.9876	V	1	1.82184	R	1	3.67477	L	1	227.2220795709933
96	Q	1	0		1	0	F	1	0.22487	S	1	0.99458	GL	1	1	G	1	1.9988700000000001	L	1	6.46343005952381	R	1	23.113456595238098	K	1	176.10300525671434	LK	2	0.50287
97		1	0	R	1	0.309995	S	1	0.58133	T	1	0.98095	L	1	73.79042506239024	SL	2	0.849465
98		1	0	L	1	0.96953	P	1	0.97199	T	1	1.4088216666666669	S	1	55.31305779485283
99		1	0	L	1	0.40731	N	1	0.74214	T	1	1.4047200000000002	S	1	60.35835593961893
100	M	1	0.07572	V	1	0.21839250000000002	L	1	0.26261	A	1	0.98543	S	1	0.99957	G	1	2.266254	P	1	63.84555612595167
101		1	0	E	1	0.45903499999999997	M	1	0.52971	R	1	0.5643	F	1	0.62412	V	1	0.63696	T	1	0.9760550000000001	P	1	0.99694	L	1	1.3337620000000001	S	1	1.7098399999999998	A	1	54.15038570867924	TA	2	0.51266
102		1	0	G	1	0.0938325	A	1	0.22846	Q	1	0.50889	R	1	1.25827	H	1	2.197766	S	1	2.9461399999999998	T	1	53.660704192699605
103		1	0	V	1	0.17607	R	1	0.301762	G	1	0.3220733333333333	A	1	0.35069	P	1	0.98058	S	1	0.99769	Q	1	1.847765	L	1	46.66483447914687	QV	2	0.33199124999999996	NL	2	1.4111599999999997	NSL	3	0.5059333333333333	SLN	3	0.51392
104		1	0	K	1	0.17857	GG	1	1	D	1	1.2741623076923076	P	1	1.8175400000000002	L	1	2.4582015	R	1	2.77205	N	1	29.138023324426854	SN	2	2.7324175	SRN	3	0.5442746666666667
105		1	0	A	1	0.12438	N	1	0.1666225	L	1	0.1877	Y	1	0.210354	E	1	0.48006666666666664	S	1	23.910050809166222	RS	2	1.5342722321428572
106		1	0	VA	1	0	N	1	1.3546799999999999	K	1	1.52352	R	1	25.178189995810467
107		1	0	K	1	0.90559	V	1	7.2518048301886795
108		1	0	A	1	7.1700114088050295
109		1	0	T	1	4.329316742138369	SL	2	2.49035
110		1	0	V	1	4.3291006037735835
111		1	0	P	1	0.99597	C	1	1	S	1	5.880255522012579	TV	2	0.257755
112	R	1	0.71553	A	1	1	L	1	5.211784213836477
113	S	1	0.04365	A	1	1	P	1	5.702727433962263	RP	2	0.19644499999999998
114	L	1	0.54368	A	1	1	R	1	4.238950943396227
115	T	1	2.77515	S	1	63.10235952380953
116	C	1	62.61356582142856
117	A	1	66.37241297619047
118	A	1	69.97958296428573
119		1	0	S	1	0.37853	T	1	0.74967	G	1	1	W	1	2	A	1	56.18377763095238
120	D	1	0		1	0	Q	1	0.11761	E	1	1	A	1	1.3208	S	1	5.44756	G	1	55.45183151190474	AS	2	0.868995
121	H	1	0		1	0	A	1	0.9696199999999999	D	1	1.79844	E	1	2.47956	C	1	2.5680300000000003	S	1	3.3725	T	1	47.704212440476184
122	Q	1	0.11401	N	1	0.14491	C	1	0.78811	G	1	1	M	1	1	S	1	2.0216700000000003	D	1	2.07819	A	1	2.60397	E	1	52.502165595238104
123		1	0	N	1	0.58067	A	1	2.27165	T	1	5.81132	S	1	14.785238666666666	C	1	39.675388738095236
124		1	0	D	1	0.01062	H	1	0.89061	A	1	2	E	1	2.543277666666667	L	1	53.55796519047619
125	L	1	72.10791340476192
126	G	1	0.95866	S	1	70.4248733690476
127		1	0	F	1	0	T	1	0.60293	L	1	0.70986	V	1	0.8147099999999999	S	1	1.99317	G	1	62.424328952380954
128		1	0	N	1	0	R	1	0.11209	D	1	0.19	S	1	1.4299	M	1	3.29155	AM	1	5.036395	G	1	9.586381428571428	W	1	38.800436499999996
129		1	0	C	1	0.29858666666666667	A	1	0.99757	N	1	1.88726	M	1	1.9472599999999998	S	1	1.99309	E	1	2.90393	G	1	53.15899866666666
130		1	0	E	1	0.15688	D	1	0.29115	L	1	0.37165333333333334	R	1	0.86341	C	1	0.96338	Q	1	0.9855099999999999	G	1	1.9996800000000001	T	1	2.1856340000000003	S	1	6.319634285714286	GG	1	10.24048	N	1	13.866631166666666	GSA	2	1.4123575000000002	SQ	2	2.709565
131		1	0	K	1	0.23769	D	1	0.36948	Q	1	0.443948	V	1	0.44667	R	1	1.9820047619047618	A	1	2.2795549999999998	S	1	3.28269	T	1	31.718305166666678
132		1	0	L	1	0.17043	N	1	0.22067	A	1	0.8395225	V	1	1.83113	R	1	9.215256666666667	K	1	36.526444785714276	SK	2	0.8140149999999999
133		1	0	L	1	0	A	1	0.08635	G	1	0.79976	E	1	0.95729	R	1	1.37245	K	1	2.9625649999999997	T	1	15.745056909090911	S	1	37.500978438095245
134		1	0	G	1	0	V	1	0.0826	A	1	0.46281	C	1	0.99172	E	1	1.164316	T	1	2.5939336363636363	S	1	55.48681445396825	GS	2	0.9880500000000001
135	V	1	0.20057	A	1	0.36125	D	1	0.79815	S	1	0.95288	G	1	60.14009190880231	SG	2	2.0672
136	V	1	0.30046666666666666	C	1	0.38816	A	1	0.53742	S	1	60.225643970995684
137	A	1	0.06888	K	1	0.49334999999999996	V	1	0.54514	C	1	0.98751	S	1	61.15191384213565	YS	2	0.588265
138	A	1	0.65907	K	1	1.7864	Y	1	61.99943238903317
139	A	1	0.64453	P	1	67.13237678614718
140	A	1	0.15542	T	1	1.95157	S	1	62.70558936681097	TV	2	0.705675
141	L	1	60.315634190620464
142	G	1	0.97839	S	1	0.99341	A	1	0.99523	L	1	62.695383271572865
143		1	0	F	1	0.30267	A	1	0.7442633333333333	L	1	0.9896	S	1	0.99163	G	1	1.2954266666666667	N	1	1.83393	C	1	3.40198	Q	1	38.04621869047619
144		1	0	K	1	0.21136333333333335	D	1	0.25572	H	1	0.45245	N	1	0.47497	L	1	0.51005	T	1	0.9130725	V	1	1.46136	A	1	2.49674	M	1	3.01269	G	1	3.23243	R	1	3.627151333333333	W	1	4.30317	S	1	7.029613333333333	C	1	13.988867817460319
145		1	0	D	1	0	G	1	0.40118	W	1	0.7071000000000001	Q	1	0.76427	S	1	0.9706478333333333	Y	1	0.99923	T	1	1.5763433333333334	A	1	1.8960399999999997	M	1	1.91707	P	1	1.98422	R	1	2.1083499999999997	L	1	13.712342841269844
146		1	0	V	1	0.21593	T	1	0.3996813333333333	Y	1	0.50379	M	1	0.5071975	G	1	0.56677	D	1	0.72126	R	1	1.1307175	S	1	1.1852	W	1	1.1896366666666667	H	1	1.41282	K	1	17.315607468253965	AK	2	0.6965975
147		1	0	M	1	0.13378	D	1	0.8642	R	1	0.91914	K	1	0.93547	H	1	0.98795	V	1	1.0431249999999999	Y	1	1.4410699999999999	A	1	7.5688785
148		1	0	M	1	0.25937	P	1	9.917622333333336
149		1	0	L	1	0.33988	A	1	0.79107	S	1	0.91949	V	1	6.788808333333334
150		1	0	N	1	0.74698	L	1	7.674416
151		1	0	P	1	0.16917	L	1	0.42028	S	1	7.874026500000001
152	N	1	0		1	0	L	1	0.57678	S	1	1.52193	D	1	6.305839999999999
153		1	0	R	1	0.44084	Y	1	0.61377	S	1	8.953716499999999
154		1	0	V	1	0.87794	S	1	6.6954389999999995	CS	2	0.72899
155		1	0	C	1	5.110389999999999
156		1	0	P	1	0.85685	S	1	0.99838	K	1	4.7976600000000005
157		1	0	A	1	0.71793	S	1	1.46013
158	N	1	0.20297	S	1	1.65662
159	H	1	0.8415	Y	1	1.6909399999999999
160	E	1	0.04841	S	1	0.5295	P	1	1.99997
161	A	1	0.99987	G	1	1.17203
162	V	1	0.99987	Q	1	1.36758
163	L	1	1.93789
164	A	1	0.97716	T	1	1
165	G	1	0	A	1	0.9326	NG	2	1
166	N	1	0.56684
167	Y	1	1	M	1	4.2747408333333325
168	L	1	6.006555972222222
169	C	1	5.026817777777778	AM	2	0.518875
170	V	1	5.026125694444445
171	G	1	6.024163888888888
172	F	1	6.016755416666666
173	L	1	6.0257056944444445
174	E	1	5.985362361111111
175	A	1	0.71231	G	1	2.9616575000000003	N	2	1.51769
176	A	1	0.42902875	G	1	2.33421
177	R	1	0.94338	K	1	4.437245555555555
178
179
180
181
182
183
184
185
186
187
188
189
190
191	D	1	0.93261
192	G	1	2.98348	QG	2	0.48434400000000005
193	Q	1	2.68368
194	L	1	3.5832420000000003
195	Q	1	2.5137080000000003	GQ	2	0.66842
196	G	1	2.045528
197	L	1	2.799998
198	V	1	2.105946
199	S	1	3.484824
200	W	1	3.49579
201	G	1	0.9947
202	Y	1	0.99786
203	P	1	0	G	1	0.99988
204	S	1	0	P	1	0.93307
205	M	1	0	G	1	0.54172
206	R	1	0	M	1	0.53721
207	K	1	0.31396
208
209
210
211
212
213
214	T	1	1.599956	KT	2	0.965375
215	A	1	0.586862	K	1	3.76534
216	R	1	0.92726	V	1	6.687965333333333	MA	2	0.32971
217		1	0	D	1	0.60101	T	1	2.2495686666666668	C	1	2.599856
218		1	0	E	1	0.16076	R	1	1.47118	A	1	1.9294559999999998	N	1	3.586024
219		1	0	L	1	4.381994	Y	1	7.066619607843137
220	V	1	21.80393380023962	AAA	2	0
221	D	1	1.1147472222222223	N	1	22.527992316010355
222	AM	1	0	MA	1	0	V	1	0.8236	W	1	23.449658449100458
223	L	1	12.085783769949005	V	1	12.974867011922502
224	AG	1	0	E	1	2.79845	Q	1	20.675352246096452
225	N	1	0.1348	E	1	2.7085283333333336	Q	1	18.31672259159468
226	T	1	23.858772857638986
227	P	1	0.26582	L	1	13.103609001405111
228	S	1	0.332	A	1	22.710558246425066
229	T	1	0.99987	A	1	23.399930240168917
230	N	1	23.9746922341353

Variant Graph

Determine stroke width:

LocalGlobal

Higher Order Variant Graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

Depth of Coverage of the Consensus Sequence

Label	Value
"0"	0
""	0
""	0
""	0
""	0
""	0
""	0
""	0
""	1.33
""	2.26
""	2.5
""	1.71
""	2.62
""	2.88
""	1.95
""	4.65
""	4.36
""	4.63
""	10.7
""	8.64
"20"	11.1
""	10.2
""	11.5
""	13.1
""	14.1
""	14.3
""	14.3
""	13.1
""	13.2
""	17.9
""	26.1
""	26.9
""	31.7
""	35.3
""	25.6
""	37.7
""	38.9
""	36.7
""	36.6
""	38.4
"40"	37.3
""	37.3
""	18.2
""	18.5
""	17
""	16.1
""	14.3
""	12.9
""	8.57
""	6.47
""	7.68
""	4.32
""	4.74
""	4.06
""	3.43
""	7.53
""	10.2
""	189
""	205
""	221
"60"	289
""	311
""	419
""	359
""	437
""	425
""	409
""	385
""	266
""	323
""	379
""	413
""	370
""	357
""	344
""	334
""	283
""	134
""	169
""	144
"80"	157
""	150
""	109
""	124
""	149
""	179
""	147
""	225
""	224
""	221
""	214
""	209
""	241
""	243
""	233
""	235
""	210
""	76.5
""	58.7
""	62.9
"100"	68.7
""	62.5
""	60.9
""	54.4
""	41.9
""	26.6
""	28.1
""	8.16
""	7.17
""	6.82
""	4.33
""	8.13
""	6.93
""	6.94
""	5.78
""	65.9
""	62.6
""	66.4
""	70
""	60.3
"120"	64.2
""	58.9
""	62.3
""	63.1
""	59
""	72.1
""	71.4
""	66.5
""	58.4
""	63.2
""	42.4
""	40.8
""	49.6
""	59.4
""	61.8
""	64.5
""	61.5
""	63.8
""	64.4
""	67.8
"140"	65.5
""	60.3
""	65.7
""	47.6
""	42
""	27
""	25.8
""	13.9
""	10.2
""	8.84
""	8.42
""	8.46
""	8.4
""	10
""	8.3
""	5.11
""	6.65
""	2.18
""	1.86
""	2.53
"160"	2.58
""	2.17
""	2.37
""	1.94
""	1.98
""	1.93
""	1.93
""	5.27
""	6.01
""	5.55
""	5.03
""	6.02
""	6.02
""	6.03
""	5.99
""	5.19
""	2.76
""	5.38
""	0
""	0
"180"	0
""	0
""	0
""	0
""	0
""	0
""	0
""	0
""	0
""	0
""	0
""	0.933
""	3.47
""	2.68
""	3.58
""	3.18
""	2.05
""	2.8
""	2.11
""	3.48
"200"	3.5
""	0.995
""	0.998
""	1
""	0.933
""	0.542
""	0.537
""	0.314
""	0
""	0
""	0
""	0
""	0
""	0
""	2.57
""	4.35
""	7.94
""	5.45
""	7.15
""	11.4
"220"	21.8
""	23.6
""	24.3
""	25.1
""	23.5
""	21.2
""	23.9
""	13.4
""	23
""	24.4
""	24

Scores

Length	Score	Matches	Unique Score	Unique Matches
231	1.277E+05	1216	1.265E+05	1201

Alignment

10 20 30 40 50 60 70 80 90 100 110 120 130 140 150 160 170 180 190 200 210 220

FPTDDDDKIVGGYTCAAN-SIPYQVSLNSGS-HFCGGSLINSQW-VVSAAHCYKSRIQVRLGE-H-N-IDV---L------E-----G---NE----QF-I-NAAKIIT-H--P---N-F--N-G-N---T----L---D-----NDIMLIK-L-S-SP-A--TLNSR-VATVSLPRSC-AAAGTEC-LIS-GW-GN-TKSSGSS-YPSLLQC--LK-APVLSDSSCKSSYPGQIT--GNMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCAQKNKPGVYTKVCNYVNWIQQTIAAN

Combined_002

Type	Read
Score	80
Start on Template	97
Length on Template	10
Start on Read	0
Length of Read	10
Unique	Yes
Positional Score
Alignment graphic

Combined_003

Type	Read
Score	64
Start on Template	107
Length on Template	8
Start on Read	0
Length of Read	8
Unique	Yes
Positional Score
Alignment graphic

Combined_008

Type	Read
Score	64
Start on Template	77
Length on Template	8
Start on Read	0
Length of Read	8
Unique	Yes
Positional Score
Alignment graphic

Combined_037

Type	Read
Score	96
Start on Template	57
Length on Template	12
Start on Read	0
Length of Read	12
Unique	Yes
Positional Score
Alignment graphic

Combined_046

Type	Read
Score	101
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_015

Type	Read
Score	105
Start on Template	115
Length on Template	18
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

Combined_047

Type	Read
Score	142
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_057

Type	Read
Score	106
Start on Template	58
Length on Template	19
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C212

Type	Read
Score	106
Start on Template	61
Length on Template	16
Start on Read	0
Length of Read	22
Unique	Yes
Positional Score
Alignment graphic

Combined_014

Type	Read
Score	80
Start on Template	87
Length on Template	10
Start on Read	0
Length of Read	10
Unique	Yes
Positional Score
Alignment graphic

C219

Type	Read
Score	129
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	22
Unique	Yes
Positional Score
Alignment graphic

C220

Type	Read
Score	97
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_016

Type	Read
Score	120
Start on Template	62
Length on Template	15
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

Combined_1426

Type	Read
Score	116
Start on Template	115
Length on Template	18
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

Combined_051

Type	Read
Score	102
Start on Template	57
Length on Template	15
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

Combined_017

Type	Read
Score	160
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_018

Type	Read
Score	109
Start on Template	117
Length on Template	16
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C263

Type	Read
Score	133
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_052

Type	Read
Score	128
Start on Template	61
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C289

Type	Read
Score	105
Start on Template	60
Length on Template	14
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

Combined_1400

Type	Read
Score	107
Start on Template	76
Length on Template	21
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_934

Type	Read
Score	112
Start on Template	83
Length on Template	14
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

Combined_1431

Type	Read
Score	158
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

Combined_061

Type	Read
Score	88
Start on Template	133
Length on Template	15
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

C555

Type	Read
Score	103
Start on Template	84
Length on Template	23
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

C80

Type	Read
Score	94
Start on Template	57
Length on Template	14
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

C81

Type	Read
Score	87
Start on Template	57
Length on Template	12
Start on Read	0
Length of Read	12
Unique	Yes
Positional Score
Alignment graphic

C130

Type	Read
Score	116
Start on Template	59
Length on Template	18
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

C173

Type	Read
Score	137
Start on Template	58
Length on Template	19
Start on Read	0
Length of Read	23
Unique	Yes
Positional Score
Alignment graphic

C184

Type	Read
Score	93
Start on Template	62
Length on Template	15
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

C193

Type	Read
Score	101
Start on Template	91
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

Combined_1440

Type	Read
Score	111
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C202

Type	Read
Score	107
Start on Template	58
Length on Template	19
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_025

Type	Read
Score	126
Start on Template	115
Length on Template	18
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

Combined_024

Type	Read
Score	134
Start on Template	57
Length on Template	19
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

Combined_058

Type	Read
Score	118
Start on Template	57
Length on Template	15
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

Combined_026

Type	Read
Score	112
Start on Template	133
Length on Template	14
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

Combined_079

Type	Read
Score	106
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_3883

Type	Read
Score	116
Start on Template	61
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

Combined_027

Type	Read
Score	96
Start on Template	85
Length on Template	12
Start on Read	0
Length of Read	12
Unique	Yes
Positional Score
Alignment graphic

Combined_028

Type	Read
Score	142
Start on Template	59
Length on Template	18
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_160

Type	Read
Score	102
Start on Template	133
Length on Template	14
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

Combined_2660

Type	Read
Score	134
Start on Template	57
Length on Template	17
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

Combined_162

Type	Read
Score	130
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_100

Type	Read
Score	107
Start on Template	91
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C437_002

Type	Read
Score	117
Start on Template	72
Length on Template	25
Start on Read	0
Length of Read	24
Unique	Yes
Positional Score
Alignment graphic

Combined_029

Type	Read
Score	85
Start on Template	133
Length on Template	14
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

Combined_062

Type	Read
Score	105
Start on Template	83
Length on Template	14
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

Combined_030

Type	Read
Score	75
Start on Template	133
Length on Template	14
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

Combined_103

Type	Read
Score	124
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C493

Type	Read
Score	128
Start on Template	59
Length on Template	18
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C537

Type	Read
Score	115
Start on Template	59
Length on Template	18
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C584

Type	Read
Score	97
Start on Template	83
Length on Template	14
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

Combined_063

Type	Read
Score	107
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_1452

Type	Read
Score	151
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_1402

Type	Read
Score	68
Start on Template	97
Length on Template	10
Start on Read	0
Length of Read	10
Unique	Yes
Positional Score
Alignment graphic

Combined_034

Type	Read
Score	64
Start on Template	69
Length on Template	8
Start on Read	0
Length of Read	8
Unique	Yes
Positional Score
Alignment graphic

Combined_055

Type	Read
Score	64
Start on Template	97
Length on Template	8
Start on Read	0
Length of Read	8
Unique	Yes
Positional Score
Alignment graphic

Combined_071

Type	Read
Score	112
Start on Template	77
Length on Template	14
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

Combined_1405

Type	Read
Score	85
Start on Template	60
Length on Template	11
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

Combined_042

Type	Read
Score	63
Start on Template	18
Length on Template	9
Start on Read	0
Length of Read	9
Unique	Yes
Positional Score
Alignment graphic

Combined_073

Type	Read
Score	72
Start on Template	18
Length on Template	9
Start on Read	0
Length of Read	9
Unique	Yes
Positional Score
Alignment graphic

C190

Type	Read
Score	141
Start on Template	58
Length on Template	19
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C204_002

Type	Read
Score	92
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_056

Type	Read
Score	101
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_043

Type	Read
Score	75
Start on Template	87
Length on Template	10
Start on Read	0
Length of Read	10
Unique	Yes
Positional Score
Alignment graphic

Combined_1439

Type	Read
Score	116
Start on Template	115
Length on Template	19
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

Combined_048

Type	Read
Score	91
Start on Template	85
Length on Template	12
Start on Read	0
Length of Read	12
Unique	Yes
Positional Score
Alignment graphic

C247

Type	Read
Score	129
Start on Template	59
Length on Template	18
Start on Read	0
Length of Read	22
Unique	Yes
Positional Score
Alignment graphic

Combined_049

Type	Read
Score	102
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_050

Type	Read
Score	119
Start on Template	91
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C262_002

Type	Read
Score	94
Start on Template	58
Length on Template	19
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

C279

Type	Read
Score	97
Start on Template	115
Length on Template	18
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

Combined_726

Type	Read
Score	120
Start on Template	57
Length on Template	15
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

Combined_078

Type	Read
Score	108
Start on Template	115
Length on Template	18
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

Combined_938

Type	Read
Score	124
Start on Template	59
Length on Template	18
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C321_002

Type	Read
Score	151
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_159

Type	Read
Score	88
Start on Template	86
Length on Template	11
Start on Read	0
Length of Read	11
Unique	Yes
Positional Score
Alignment graphic

Combined_2471

Type	Read
Score	119
Start on Template	61
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C391

Type	Read
Score	106
Start on Template	60
Length on Template	17
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_1415

Type	Read
Score	107
Start on Template	91
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

Combined_724

Type	Read
Score	131
Start on Template	57
Length on Template	17
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C543

Type	Read
Score	113
Start on Template	78
Length on Template	19
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

C546

Type	Read
Score	123
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_031

Type	Read
Score	107
Start on Template	83
Length on Template	14
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

C584_002

Type	Read
Score	80
Start on Template	133
Length on Template	14
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

C590

Type	Read
Score	124
Start on Template	78
Length on Template	19
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C649

Type	Read
Score	120
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	25
Unique	Yes
Positional Score
Alignment graphic

C795

Type	Read
Score	142
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	22
Unique	Yes
Positional Score
Alignment graphic

C835

Type	Read
Score	116
Start on Template	57
Length on Template	28
Start on Read	0
Length of Read	28
Unique	Yes
Positional Score
Alignment graphic

Combined_3129

Type	Read
Score	142
Start on Template	59
Length on Template	18
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_1471

Type	Read
Score	121
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C258_002

Type	Read
Score	104
Start on Template	115
Length on Template	18
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C266_002

Type	Read
Score	97
Start on Template	115
Length on Template	24
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C270

Type	Read
Score	116
Start on Template	56
Length on Template	21
Start on Read	0
Length of Read	23
Unique	Yes
Positional Score
Alignment graphic

C316

Type	Read
Score	130
Start on Template	59
Length on Template	18
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

C336

Type	Read
Score	99
Start on Template	115
Length on Template	18
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

C340_002

Type	Read
Score	123
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_059

Type	Read
Score	142
Start on Template	59
Length on Template	18
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_080

Type	Read
Score	107
Start on Template	133
Length on Template	14
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

Combined_1508

Type	Read
Score	96
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C505

Type	Read
Score	101
Start on Template	192
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

Combined_084

Type	Read
Score	97
Start on Template	83
Length on Template	14
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

C545

Type	Read
Score	85
Start on Template	133
Length on Template	14
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

C600

Type	Read
Score	137
Start on Template	78
Length on Template	19
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_085

Type	Read
Score	155
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C671

Type	Read
Score	99
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

Combined_066

Type	Read
Score	80
Start on Template	147
Length on Template	10
Start on Read	0
Length of Read	10
Unique	Yes
Positional Score
Alignment graphic

Combined_068

Type	Read
Score	75
Start on Template	97
Length on Template	10
Start on Read	0
Length of Read	10
Unique	Yes
Positional Score
Alignment graphic

Combined_092

Type	Read
Score	112
Start on Template	57
Length on Template	14
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

Combined_3827

Type	Read
Score	151
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C208

Type	Read
Score	97
Start on Template	61
Length on Template	16
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

Combined_1652

Type	Read
Score	134
Start on Template	115
Length on Template	18
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

C239

Type	Read
Score	105
Start on Template	115
Length on Template	18
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C261_003

Type	Read
Score	106
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_075

Type	Read
Score	95
Start on Template	115
Length on Template	19
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C301_002

Type	Read
Score	113
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

Combined_077

Type	Read
Score	142
Start on Template	58
Length on Template	19
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_1428

Type	Read
Score	98
Start on Template	115
Length on Template	19
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

Combined_101

Type	Read
Score	115
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C376

Type	Read
Score	97
Start on Template	133
Length on Template	14
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

C386

Type	Read
Score	85
Start on Template	134
Length on Template	13
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

C392

Type	Read
Score	100
Start on Template	58
Length on Template	16
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C406_002

Type	Read
Score	119
Start on Template	58
Length on Template	19
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C444_002

Type	Read
Score	111
Start on Template	78
Length on Template	19
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

C446

Type	Read
Score	124
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_163

Type	Read
Score	116
Start on Template	91
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

Combined_083

Type	Read
Score	84
Start on Template	192
Length on Template	15
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

C581_002

Type	Read
Score	112
Start on Template	79
Length on Template	18
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

Combined_1432

Type	Read
Score	144
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

Combined_1401

Type	Read
Score	125
Start on Template	58
Length on Template	19
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C629

Type	Read
Score	104
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C775

Type	Read
Score	115
Start on Template	78
Length on Template	19
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_1796

Type	Read
Score	146
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C787

Type	Read
Score	119
Start on Template	78
Length on Template	19
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_148

Type	Read
Score	100
Start on Template	57
Length on Template	14
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

Combined_1480

Type	Read
Score	119
Start on Template	115
Length on Template	23
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C274

Type	Read
Score	120
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	22
Unique	Yes
Positional Score
Alignment graphic

C277_002

Type	Read
Score	128
Start on Template	59
Length on Template	18
Start on Read	0
Length of Read	23
Unique	Yes
Positional Score
Alignment graphic

C289_003

Type	Read
Score	110
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C291_002

Type	Read
Score	121
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C301_003

Type	Read
Score	106
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C308_002

Type	Read
Score	106
Start on Template	60
Length on Template	17
Start on Read	0
Length of Read	22
Unique	Yes
Positional Score
Alignment graphic

Combined_096

Type	Read
Score	138
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	22
Unique	Yes
Positional Score
Alignment graphic

C314_002

Type	Read
Score	106
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C315

Type	Read
Score	96
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	22
Unique	Yes
Positional Score
Alignment graphic

Combined_097

Type	Read
Score	133
Start on Template	58
Length on Template	19
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_924

Type	Read
Score	133
Start on Template	60
Length on Template	17
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C607

Type	Read
Score	100
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	23
Unique	Yes
Positional Score
Alignment graphic

Combined_102

Type	Read
Score	153
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

C612

Type	Read
Score	101
Start on Template	78
Length on Template	19
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C613

Type	Read
Score	102
Start on Template	72
Length on Template	25
Start on Read	0
Length of Read	24
Unique	Yes
Positional Score
Alignment graphic

C624

Type	Read
Score	83
Start on Template	133
Length on Template	15
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

Combined_2952

Type	Read
Score	98
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C731

Type	Read
Score	124
Start on Template	87
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_1380

Type	Read
Score	148
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_1412

Type	Read
Score	123
Start on Template	78
Length on Template	19
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_1047

Type	Read
Score	87
Start on Template	95
Length on Template	12
Start on Read	0
Length of Read	12
Unique	Yes
Positional Score
Alignment graphic

C706

Type	Read
Score	141
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	23
Unique	Yes
Positional Score
Alignment graphic

C734

Type	Read
Score	93
Start on Template	62
Length on Template	15
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

C755

Type	Read
Score	89
Start on Template	78
Length on Template	19
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C793

Type	Read
Score	93
Start on Template	61
Length on Template	15
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

C802

Type	Read
Score	82
Start on Template	84
Length on Template	13
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

C958

Type	Read
Score	95
Start on Template	83
Length on Template	14
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

C981_002

Type	Read
Score	109
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	24
Unique	Yes
Positional Score
Alignment graphic

Combined_223

Type	Read
Score	112
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_1458

Type	Read
Score	143
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1103

Type	Read
Score	75
Start on Template	133
Length on Template	14
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

C1198

Type	Read
Score	124
Start on Template	59
Length on Template	18
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_1450

Type	Read
Score	153
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

Combined_712

Type	Read
Score	64
Start on Template	223
Length on Template	8
Start on Read	0
Length of Read	8
Unique	Yes
Positional Score
Alignment graphic

Combined_1460

Type	Read
Score	70
Start on Template	8
Length on Template	10
Start on Read	0
Length of Read	9
Unique	Yes
Positional Score
Alignment graphic

Combined_213

Type	Read
Score	144
Start on Template	115
Length on Template	18
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

C679

Type	Read
Score	118
Start on Template	115
Length on Template	24
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C685_002

Type	Read
Score	144
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	25
Unique	Yes
Positional Score
Alignment graphic

C694_002

Type	Read
Score	79
Start on Template	62
Length on Template	15
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

C734_002

Type	Read
Score	106
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_1427

Type	Read
Score	108
Start on Template	62
Length on Template	15
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

C772

Type	Read
Score	117
Start on Template	115
Length on Template	18
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

C782_002

Type	Read
Score	105
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_3852

Type	Read
Score	118
Start on Template	61
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

Combined_2514

Type	Read
Score	97
Start on Template	60
Length on Template	17
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_219

Type	Read
Score	120
Start on Template	78
Length on Template	19
Start on Read	0
Length of Read	22
Unique	Yes
Positional Score
Alignment graphic

C1055

Type	Read
Score	89
Start on Template	133
Length on Template	14
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

C1190

Type	Read
Score	106
Start on Template	78
Length on Template	19
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

C1220

Type	Read
Score	124
Start on Template	78
Length on Template	19
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_3131

Type	Read
Score	135
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

Combined_1434

Type	Read
Score	150
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_1589

Type	Read
Score	73
Start on Template	97
Length on Template	10
Start on Read	0
Length of Read	12
Unique	Yes
Positional Score
Alignment graphic

C621

Type	Read
Score	106
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_1424

Type	Read
Score	115
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C693

Type	Read
Score	102
Start on Template	60
Length on Template	17
Start on Read	0
Length of Read	22
Unique	Yes
Positional Score
Alignment graphic

C765

Type	Read
Score	96
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C819

Type	Read
Score	101
Start on Template	115
Length on Template	18
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C822

Type	Read
Score	82
Start on Template	84
Length on Template	13
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

C902

Type	Read
Score	115
Start on Template	62
Length on Template	15
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C919_002

Type	Read
Score	110
Start on Template	91
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C1020_002

Type	Read
Score	146
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	22
Unique	Yes
Positional Score
Alignment graphic

C1066

Type	Read
Score	84
Start on Template	133
Length on Template	14
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

C1073_002

Type	Read
Score	137
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1123_002

Type	Read
Score	105
Start on Template	78
Length on Template	19
Start on Read	0
Length of Read	26
Unique	Yes
Positional Score
Alignment graphic

C1132

Type	Read
Score	124
Start on Template	59
Length on Template	18
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_937

Type	Read
Score	96
Start on Template	219
Length on Template	12
Start on Read	0
Length of Read	12
Unique	Yes
Positional Score
Alignment graphic

C1379

Type	Read
Score	106
Start on Template	57
Length on Template	28
Start on Read	0
Length of Read	27
Unique	Yes
Positional Score
Alignment graphic

C1422_002

Type	Read
Score	140
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

Combined_311

Type	Read
Score	79
Start on Template	220
Length on Template	11
Start on Read	0
Length of Read	11
Unique	Yes
Positional Score
Alignment graphic

Combined_317

Type	Read
Score	74
Start on Template	220
Length on Template	11
Start on Read	0
Length of Read	11
Unique	Yes
Positional Score
Alignment graphic

Combined_320

Type	Read
Score	63
Start on Template	87
Length on Template	9
Start on Read	0
Length of Read	9
Unique	Yes
Positional Score
Alignment graphic

Combined_616

Type	Read
Score	77
Start on Template	220
Length on Template	11
Start on Read	0
Length of Read	13
Unique	Yes
Positional Score
Alignment graphic

Combined_528

Type	Read
Score	56
Start on Template	30
Length on Template	7
Start on Read	0
Length of Read	7
Unique	Yes
Positional Score
Alignment graphic

Combined_409

Type	Read
Score	63
Start on Template	222
Length on Template	9
Start on Read	0
Length of Read	9
Unique	Yes
Positional Score
Alignment graphic

Combined_722

Type	Read
Score	66
Start on Template	32
Length on Template	10
Start on Read	0
Length of Read	10
Unique	Yes
Positional Score
Alignment graphic

C860

Type	Read
Score	77
Start on Template	30
Length on Template	12
Start on Read	0
Length of Read	12
Unique	Yes
Positional Score
Alignment graphic

C1052_003

Type	Read
Score	92
Start on Template	215
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

Combined_710

Type	Read
Score	72
Start on Template	98
Length on Template	9
Start on Read	0
Length of Read	9
Unique	Yes
Positional Score
Alignment graphic

Combined_861

Type	Read
Score	56
Start on Template	100
Length on Template	7
Start on Read	0
Length of Read	7
Unique	Yes
Positional Score
Alignment graphic

Combined_736

Type	Read
Score	66
Start on Template	98
Length on Template	9
Start on Read	0
Length of Read	10
Unique	Yes
Positional Score
Alignment graphic

Combined_863

Type	Read
Score	64
Start on Template	42
Length on Template	8
Start on Read	0
Length of Read	8
Unique	Yes
Positional Score
Alignment graphic

C266_006

Type	Read
Score	63
Start on Template	42
Length on Template	8
Start on Read	0
Length of Read	9
Unique	Yes
Positional Score
Alignment graphic

C284_005

Type	Read
Score	63
Start on Template	223
Length on Template	8
Start on Read	0
Length of Read	9
Unique	Yes
Positional Score
Alignment graphic

Combined_865

Type	Read
Score	68
Start on Template	97
Length on Template	10
Start on Read	0
Length of Read	10
Unique	Yes
Positional Score
Alignment graphic

C435_002

Type	Read
Score	54
Start on Template	29
Length on Template	8
Start on Read	0
Length of Read	7
Unique	Yes
Positional Score
Alignment graphic

C529_004

Type	Read
Score	59
Start on Template	96
Length on Template	8
Start on Read	0
Length of Read	8
Unique	Yes
Positional Score
Alignment graphic

Combined_714

Type	Read
Score	80
Start on Template	22
Length on Template	10
Start on Read	0
Length of Read	10
Unique	Yes
Positional Score
Alignment graphic

Combined_760

Type	Read
Score	80
Start on Template	77
Length on Template	10
Start on Read	0
Length of Read	10
Unique	Yes
Positional Score
Alignment graphic

C608_003

Type	Read
Score	68
Start on Template	105
Length on Template	10
Start on Read	0
Length of Read	11
Unique	Yes
Positional Score
Alignment graphic

Combined_762

Type	Read
Score	83
Start on Template	104
Length on Template	11
Start on Read	0
Length of Read	11
Unique	Yes
Positional Score
Alignment graphic

Combined_765

Type	Read
Score	59
Start on Template	77
Length on Template	8
Start on Read	0
Length of Read	8
Unique	Yes
Positional Score
Alignment graphic

Combined_718

Type	Read
Score	70
Start on Template	22
Length on Template	10
Start on Read	0
Length of Read	11
Unique	Yes
Positional Score
Alignment graphic

C745_003

Type	Read
Score	56
Start on Template	77
Length on Template	7
Start on Read	0
Length of Read	7
Unique	Yes
Positional Score
Alignment graphic

Combined_1050

Type	Read
Score	72
Start on Template	13
Length on Template	9
Start on Read	0
Length of Read	9
Unique	Yes
Positional Score
Alignment graphic

C870

Type	Read
Score	70
Start on Template	72
Length on Template	11
Start on Read	0
Length of Read	11
Unique	Yes
Positional Score
Alignment graphic

Combined_904

Type	Read
Score	72
Start on Template	95
Length on Template	9
Start on Read	0
Length of Read	9
Unique	Yes
Positional Score
Alignment graphic

Combined_781

Type	Read
Score	62
Start on Template	57
Length on Template	9
Start on Read	0
Length of Read	9
Unique	Yes
Positional Score
Alignment graphic

Combined_783

Type	Read
Score	96
Start on Template	77
Length on Template	12
Start on Read	0
Length of Read	12
Unique	Yes
Positional Score
Alignment graphic

C1151

Type	Read
Score	63
Start on Template	57
Length on Template	9
Start on Read	0
Length of Read	9
Unique	Yes
Positional Score
Alignment graphic

C1295_003

Type	Read
Score	70
Start on Template	32
Length on Template	11
Start on Read	0
Length of Read	11
Unique	Yes
Positional Score
Alignment graphic

C1320_002

Type	Read
Score	91
Start on Template	77
Length on Template	12
Start on Read	0
Length of Read	12
Unique	Yes
Positional Score
Alignment graphic

C1334_002

Type	Read
Score	90
Start on Template	77
Length on Template	12
Start on Read	0
Length of Read	13
Unique	Yes
Positional Score
Alignment graphic

Combined_795

Type	Read
Score	70
Start on Template	94
Length on Template	10
Start on Read	0
Length of Read	11
Unique	Yes
Positional Score
Alignment graphic

C1501_004

Type	Read
Score	92
Start on Template	59
Length on Template	13
Start on Read	0
Length of Read	13
Unique	Yes
Positional Score
Alignment graphic

Combined_920

Type	Read
Score	146
Start on Template	58
Length on Template	19
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1616_004

Type	Read
Score	68
Start on Template	133
Length on Template	10
Start on Read	0
Length of Read	11
Unique	Yes
Positional Score
Alignment graphic

Combined_1270

Type	Read
Score	124
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1681_002

Type	Read
Score	102
Start on Template	57
Length on Template	15
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

C1715_004

Type	Read
Score	81
Start on Template	59
Length on Template	13
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

Combined_805

Type	Read
Score	82
Start on Template	30
Length on Template	12
Start on Read	0
Length of Read	12
Unique	Yes
Positional Score
Alignment graphic

C1726_005

Type	Read
Score	88
Start on Template	59
Length on Template	13
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

C1735_004

Type	Read
Score	88
Start on Template	58
Length on Template	14
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

Combined_725

Type	Read
Score	99
Start on Template	57
Length on Template	15
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

C1749_002

Type	Read
Score	113
Start on Template	77
Length on Template	17
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

Combined_809

Type	Read
Score	97
Start on Template	57
Length on Template	17
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

Combined_3637

Type	Read
Score	115
Start on Template	57
Length on Template	15
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

Combined_810

Type	Read
Score	80
Start on Template	62
Length on Template	10
Start on Read	0
Length of Read	10
Unique	Yes
Positional Score
Alignment graphic

C1812_003

Type	Read
Score	115
Start on Template	77
Length on Template	18
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C1834_004

Type	Read
Score	118
Start on Template	58
Length on Template	19
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1848_002

Type	Read
Score	118
Start on Template	59
Length on Template	15
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C1866_007

Type	Read
Score	83
Start on Template	57
Length on Template	15
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C1870_007

Type	Read
Score	140
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

C1893_003

Type	Read
Score	102
Start on Template	57
Length on Template	15
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

Combined_817

Type	Read
Score	93
Start on Template	60
Length on Template	12
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

Combined_819

Type	Read
Score	84
Start on Template	61
Length on Template	11
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

C1957_004

Type	Read
Score	95
Start on Template	60
Length on Template	12
Start on Read	0
Length of Read	13
Unique	Yes
Positional Score
Alignment graphic

Combined_821

Type	Read
Score	88
Start on Template	61
Length on Template	11
Start on Read	0
Length of Read	11
Unique	Yes
Positional Score
Alignment graphic

Combined_1196

Type	Read
Score	102
Start on Template	59
Length on Template	13
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

C2040_003

Type	Read
Score	111
Start on Template	57
Length on Template	15
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

C2083_002

Type	Read
Score	90
Start on Template	59
Length on Template	13
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

Combined_825

Type	Read
Score	104
Start on Template	61
Length on Template	13
Start on Read	0
Length of Read	13
Unique	Yes
Positional Score
Alignment graphic

Combined_877

Type	Read
Score	88
Start on Template	220
Length on Template	11
Start on Read	0
Length of Read	11
Unique	Yes
Positional Score
Alignment graphic

Combined_826

Type	Read
Score	156
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	22
Unique	Yes
Positional Score
Alignment graphic

C2128_002

Type	Read
Score	73
Start on Template	220
Length on Template	11
Start on Read	0
Length of Read	12
Unique	Yes
Positional Score
Alignment graphic

C2163

Type	Read
Score	64
Start on Template	220
Length on Template	8
Start on Read	0
Length of Read	8
Unique	Yes
Positional Score
Alignment graphic

C2180

Type	Read
Score	94
Start on Template	79
Length on Template	16
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

C2195

Type	Read
Score	125
Start on Template	57
Length on Template	17
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

Combined_1815

Type	Read
Score	85
Start on Template	32
Length on Template	13
Start on Read	0
Length of Read	13
Unique	Yes
Positional Score
Alignment graphic

C2358

Type	Read
Score	98
Start on Template	57
Length on Template	15
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C2395

Type	Read
Score	90
Start on Template	59
Length on Template	13
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

C2413

Type	Read
Score	126
Start on Template	77
Length on Template	18
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C2494

Type	Read
Score	91
Start on Template	60
Length on Template	12
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C2497

Type	Read
Score	110
Start on Template	57
Length on Template	15
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

Combined_1120

Type	Read
Score	80
Start on Template	32
Length on Template	10
Start on Read	0
Length of Read	10
Unique	Yes
Positional Score
Alignment graphic

C2694

Type	Read
Score	92
Start on Template	58
Length on Template	14
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

Combined_837

Type	Read
Score	83
Start on Template	32
Length on Template	15
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

C2993

Type	Read
Score	83
Start on Template	58
Length on Template	14
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C3045

Type	Read
Score	80
Start on Template	58
Length on Template	14
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

Combined_852

Type	Read
Score	93
Start on Template	60
Length on Template	12
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

Combined_855

Type	Read
Score	80
Start on Template	60
Length on Template	12
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C135_004

Type	Read
Score	63
Start on Template	146
Length on Template	9
Start on Read	0
Length of Read	9
Unique	Yes
Positional Score
Alignment graphic

C409_003

Type	Read
Score	64
Start on Template	96
Length on Template	8
Start on Read	0
Length of Read	8
Unique	Yes
Positional Score
Alignment graphic

C506_005

Type	Read
Score	68
Start on Template	77
Length on Template	10
Start on Read	0
Length of Read	11
Unique	Yes
Positional Score
Alignment graphic

C729_004

Type	Read
Score	70
Start on Template	83
Length on Template	11
Start on Read	0
Length of Read	11
Unique	Yes
Positional Score
Alignment graphic

Combined_2710

Type	Read
Score	85
Start on Template	60
Length on Template	11
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

C918_005

Type	Read
Score	88
Start on Template	129
Length on Template	14
Start on Read	0
Length of Read	15
Unique	No
Positional Score
Alignment graphic

C966_005

Type	Read
Score	74
Start on Template	94
Length on Template	11
Start on Read	0
Length of Read	12
Unique	Yes
Positional Score
Alignment graphic

C991_003

Type	Read
Score	72
Start on Template	32
Length on Template	9
Start on Read	0
Length of Read	9
Unique	Yes
Positional Score
Alignment graphic

Combined_3460

Type	Read
Score	71
Start on Template	57
Length on Template	9
Start on Read	0
Length of Read	10
Unique	Yes
Positional Score
Alignment graphic

C1164_004

Type	Read
Score	75
Start on Template	32
Length on Template	10
Start on Read	0
Length of Read	11
Unique	Yes
Positional Score
Alignment graphic

C1272

Type	Read
Score	126
Start on Template	77
Length on Template	17
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C1401_002

Type	Read
Score	68
Start on Template	133
Length on Template	10
Start on Read	0
Length of Read	10
Unique	No
Positional Score
Alignment graphic

C1560_003

Type	Read
Score	108
Start on Template	57
Length on Template	15
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

C1561_002

Type	Read
Score	79
Start on Template	133
Length on Template	10
Start on Read	0
Length of Read	11
Unique	Yes
Positional Score
Alignment graphic

C1567_004

Type	Read
Score	60
Start on Template	134
Length on Template	9
Start on Read	0
Length of Read	9
Unique	Yes
Positional Score
Alignment graphic

C1588_002

Type	Read
Score	89
Start on Template	58
Length on Template	14
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C1604_002

Type	Read
Score	111
Start on Template	57
Length on Template	15
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

Combined_860

Type	Read
Score	111
Start on Template	57
Length on Template	15
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

C1621

Type	Read
Score	88
Start on Template	59
Length on Template	13
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

C1697

Type	Read
Score	99
Start on Template	77
Length on Template	18
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

C1724_002

Type	Read
Score	118
Start on Template	58
Length on Template	19
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1772

Type	Read
Score	88
Start on Template	57
Length on Template	15
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C1790_003

Type	Read
Score	89
Start on Template	58
Length on Template	14
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C1853_004

Type	Read
Score	97
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1859_003

Type	Read
Score	83
Start on Template	60
Length on Template	12
Start on Read	0
Length of Read	13
Unique	Yes
Positional Score
Alignment graphic

Combined_875

Type	Read
Score	136
Start on Template	57
Length on Template	17
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C1881_005

Type	Read
Score	81
Start on Template	58
Length on Template	14
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

C1900_003

Type	Read
Score	93
Start on Template	60
Length on Template	12
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

C1950_003

Type	Read
Score	90
Start on Template	57
Length on Template	15
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

C2016

Type	Read
Score	70
Start on Template	221
Length on Template	10
Start on Read	0
Length of Read	11
Unique	Yes
Positional Score
Alignment graphic

C2101_002

Type	Read
Score	90
Start on Template	57
Length on Template	15
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

Combined_1131

Type	Read
Score	60
Start on Template	192
Length on Template	9
Start on Read	0
Length of Read	9
Unique	Yes
Positional Score
Alignment graphic

C2186

Type	Read
Score	107
Start on Template	56
Length on Template	16
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C2278

Type	Read
Score	83
Start on Template	220
Length on Template	11
Start on Read	0
Length of Read	11
Unique	Yes
Positional Score
Alignment graphic

C2286

Type	Read
Score	80
Start on Template	57
Length on Template	15
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

Combined_1126

Type	Read
Score	86
Start on Template	57
Length on Template	15
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C2322

Type	Read
Score	93
Start on Template	60
Length on Template	12
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

C2562

Type	Read
Score	81
Start on Template	60
Length on Template	12
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

C2965

Type	Read
Score	84
Start on Template	61
Length on Template	11
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

C3061_002

Type	Read
Score	81
Start on Template	59
Length on Template	13
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

Combined_1077

Type	Read
Score	83
Start on Template	32
Length on Template	15
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

Combined_1371

Type	Read
Score	108
Start on Template	57
Length on Template	15
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

C236_004

Type	Read
Score	74
Start on Template	94
Length on Template	13
Start on Read	0
Length of Read	13
Unique	Yes
Positional Score
Alignment graphic

Combined_901

Type	Read
Score	86
Start on Template	95
Length on Template	12
Start on Read	0
Length of Read	13
Unique	Yes
Positional Score
Alignment graphic

C924_002

Type	Read
Score	119
Start on Template	58
Length on Template	19
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_912

Type	Read
Score	80
Start on Template	133
Length on Template	10
Start on Read	0
Length of Read	10
Unique	Yes
Positional Score
Alignment graphic

C959_004

Type	Read
Score	119
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	22
Unique	Yes
Positional Score
Alignment graphic

C977_002

Type	Read
Score	88
Start on Template	29
Length on Template	13
Start on Read	0
Length of Read	13
Unique	Yes
Positional Score
Alignment graphic

C986

Type	Read
Score	95
Start on Template	115
Length on Template	19
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

Combined_1127

Type	Read
Score	72
Start on Template	30
Length on Template	12
Start on Read	0
Length of Read	11
Unique	Yes
Positional Score
Alignment graphic

C1007

Type	Read
Score	100
Start on Template	115
Length on Template	21
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C1010_003

Type	Read
Score	106
Start on Template	57
Length on Template	15
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

Combined_988

Type	Read
Score	137
Start on Template	58
Length on Template	19
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1065_002

Type	Read
Score	90
Start on Template	59
Length on Template	13
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

C1087_005

Type	Read
Score	124
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1098_002

Type	Read
Score	101
Start on Template	60
Length on Template	17
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_923

Type	Read
Score	124
Start on Template	61
Length on Template	16
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_999

Type	Read
Score	135
Start on Template	57
Length on Template	18
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

Combined_3016

Type	Read
Score	119
Start on Template	78
Length on Template	19
Start on Read	0
Length of Read	22
Unique	Yes
Positional Score
Alignment graphic

Combined_926

Type	Read
Score	83
Start on Template	220
Length on Template	11
Start on Read	0
Length of Read	11
Unique	Yes
Positional Score
Alignment graphic

Combined_1072

Type	Read
Score	76
Start on Template	133
Length on Template	14
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

C1246_002

Type	Read
Score	127
Start on Template	77
Length on Template	18
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

Combined_1005

Type	Read
Score	77
Start on Template	84
Length on Template	13
Start on Read	0
Length of Read	13
Unique	No
Positional Score
Alignment graphic

Combined_1074

Type	Read
Score	80
Start on Template	133
Length on Template	14
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

Combined_1378

Type	Read
Score	105
Start on Template	85
Length on Template	21
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

Combined_1208

Type	Read
Score	81
Start on Template	28
Length on Template	14
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

C1506_003

Type	Read
Score	131
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

Combined_940

Type	Read
Score	95
Start on Template	91
Length on Template	13
Start on Read	0
Length of Read	13
Unique	Yes
Positional Score
Alignment graphic

Combined_941

Type	Read
Score	79
Start on Template	87
Length on Template	11
Start on Read	0
Length of Read	11
Unique	Yes
Positional Score
Alignment graphic

Combined_1216

Type	Read
Score	127
Start on Template	78
Length on Template	20
Start on Read	0
Length of Read	23
Unique	Yes
Positional Score
Alignment graphic

Combined_945

Type	Read
Score	95
Start on Template	85
Length on Template	13
Start on Read	0
Length of Read	13
Unique	Yes
Positional Score
Alignment graphic

C1687_002

Type	Read
Score	86
Start on Template	219
Length on Template	12
Start on Read	0
Length of Read	13
Unique	Yes
Positional Score
Alignment graphic

C1697_002

Type	Read
Score	114
Start on Template	78
Length on Template	20
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

Combined_1219

Type	Read
Score	143
Start on Template	85
Length on Template	19
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

Combined_1086

Type	Read
Score	60
Start on Template	98
Length on Template	9
Start on Read	0
Length of Read	9
Unique	No
Positional Score
Alignment graphic

Combined_972

Type	Read
Score	72
Start on Template	222
Length on Template	9
Start on Read	0
Length of Read	9
Unique	Yes
Positional Score
Alignment graphic

C833_003

Type	Read
Score	107
Start on Template	77
Length on Template	14
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

C847_003

Type	Read
Score	79
Start on Template	125
Length on Template	18
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

Combined_976

Type	Read
Score	70
Start on Template	95
Length on Template	10
Start on Read	0
Length of Read	11
Unique	Yes
Positional Score
Alignment graphic

C995

Type	Read
Score	60
Start on Template	214
Length on Template	9
Start on Read	0
Length of Read	9
Unique	Yes
Positional Score
Alignment graphic

Combined_1058

Type	Read
Score	66
Start on Template	87
Length on Template	10
Start on Read	0
Length of Read	10
Unique	Yes
Positional Score
Alignment graphic

C1192_004

Type	Read
Score	113
Start on Template	77
Length on Template	17
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

Combined_1361

Type	Read
Score	121
Start on Template	58
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_990

Type	Read
Score	112
Start on Template	18
Length on Template	14
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

Combined_1261

Type	Read
Score	56
Start on Template	216
Length on Template	7
Start on Read	0
Length of Read	7
Unique	Yes
Positional Score
Alignment graphic

Combined_991

Type	Read
Score	136
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	23
Unique	Yes
Positional Score
Alignment graphic

Combined_1264

Type	Read
Score	111
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_1117

Type	Read
Score	93
Start on Template	118
Length on Template	18
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_992

Type	Read
Score	70
Start on Template	133
Length on Template	10
Start on Read	0
Length of Read	10
Unique	Yes
Positional Score
Alignment graphic

Combined_1063

Type	Read
Score	107
Start on Template	115
Length on Template	19
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

Combined_994

Type	Read
Score	97
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1445_003

Type	Read
Score	99
Start on Template	62
Length on Template	15
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

C1457_004

Type	Read
Score	107
Start on Template	59
Length on Template	17
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C1491_004

Type	Read
Score	109
Start on Template	76
Length on Template	21
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

Combined_1190

Type	Read
Score	136
Start on Template	77
Length on Template	17
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

Combined_1191

Type	Read
Score	103
Start on Template	29
Length on Template	13
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

Combined_996

Type	Read
Score	86
Start on Template	55
Length on Template	17
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

Combined_995

Type	Read
Score	92
Start on Template	29
Length on Template	13
Start on Read	0
Length of Read	13
Unique	Yes
Positional Score
Alignment graphic

C1563_005

Type	Read
Score	94
Start on Template	134
Length on Template	13
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

Combined_1067

Type	Read
Score	124
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_1123

Type	Read
Score	137
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_1125

Type	Read
Score	101
Start on Template	91
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

Combined_1195

Type	Read
Score	144
Start on Template	57
Length on Template	18
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

Combined_3954

Type	Read
Score	110
Start on Template	78
Length on Template	19
Start on Read	0
Length of Read	22
Unique	Yes
Positional Score
Alignment graphic

C1776_002

Type	Read
Score	85
Start on Template	61
Length on Template	11
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

Combined_2948

Type	Read
Score	109
Start on Template	8
Length on Template	24
Start on Read	0
Length of Read	22
Unique	Yes
Positional Score
Alignment graphic

Combined_1007

Type	Read
Score	64
Start on Template	31
Length on Template	11
Start on Read	0
Length of Read	10
Unique	Yes
Positional Score
Alignment graphic

C2063

Type	Read
Score	110
Start on Template	58
Length on Template	21
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

C2065

Type	Read
Score	100
Start on Template	22
Length on Template	20
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

Combined_1206

Type	Read
Score	157
Start on Template	58
Length on Template	25
Start on Read	0
Length of Read	27
Unique	Yes
Positional Score
Alignment graphic

C2069_002

Type	Read
Score	81
Start on Template	30
Length on Template	12
Start on Read	0
Length of Read	13
Unique	Yes
Positional Score
Alignment graphic

C2120_002

Type	Read
Score	115
Start on Template	85
Length on Template	29
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

Combined_1136

Type	Read
Score	85
Start on Template	32
Length on Template	13
Start on Read	0
Length of Read	13
Unique	Yes
Positional Score
Alignment graphic

Combined_1011

Type	Read
Score	79
Start on Template	30
Length on Template	12
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

C2221

Type	Read
Score	96
Start on Template	32
Length on Template	18
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C2230_002

Type	Read
Score	156
Start on Template	133
Length on Template	24
Start on Read	0
Length of Read	24
Unique	Yes
Positional Score
Alignment graphic

Combined_1554

Type	Read
Score	105
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	22
Unique	Yes
Positional Score
Alignment graphic

C2440

Type	Read
Score	79
Start on Template	32
Length on Template	15
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

C2477

Type	Read
Score	125
Start on Template	78
Length on Template	20
Start on Read	0
Length of Read	24
Unique	Yes
Positional Score
Alignment graphic

Combined_1016

Type	Read
Score	127
Start on Template	87
Length on Template	17
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

Combined_2487

Type	Read
Score	104
Start on Template	218
Length on Template	13
Start on Read	0
Length of Read	13
Unique	Yes
Positional Score
Alignment graphic

C2608_002

Type	Read
Score	118
Start on Template	77
Length on Template	21
Start on Read	0
Length of Read	25
Unique	Yes
Positional Score
Alignment graphic

C2615

Type	Read
Score	114
Start on Template	61
Length on Template	16
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_1283

Type	Read
Score	73
Start on Template	31
Length on Template	11
Start on Read	0
Length of Read	12
Unique	Yes
Positional Score
Alignment graphic

C2913_002

Type	Read
Score	79
Start on Template	216
Length on Template	15
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

C177_009

Type	Read
Score	78
Start on Template	96
Length on Template	11
Start on Read	0
Length of Read	11
Unique	Yes
Positional Score
Alignment graphic

Combined_1061

Type	Read
Score	143
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1358_004

Type	Read
Score	95
Start on Template	55
Length on Template	22
Start on Read	0
Length of Read	22
Unique	Yes
Positional Score
Alignment graphic

C1387_006

Type	Read
Score	105
Start on Template	115
Length on Template	19
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

Combined_1119

Type	Read
Score	98
Start on Template	132
Length on Template	15
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C1428_003

Type	Read
Score	89
Start on Template	8
Length on Template	14
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

Combined_1064

Type	Read
Score	97
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1554_006

Type	Read
Score	115
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_1122

Type	Read
Score	66
Start on Template	134
Length on Template	9
Start on Read	0
Length of Read	10
Unique	Yes
Positional Score
Alignment graphic

Combined_1068

Type	Read
Score	106
Start on Template	60
Length on Template	17
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1614_006

Type	Read
Score	101
Start on Template	78
Length on Template	19
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

Combined_2732

Type	Read
Score	101
Start on Template	91
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

Combined_1408

Type	Read
Score	113
Start on Template	75
Length on Template	22
Start on Read	0
Length of Read	22
Unique	Yes
Positional Score
Alignment graphic

C1721_003

Type	Read
Score	81
Start on Template	60
Length on Template	12
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

Combined_1372

Type	Read
Score	111
Start on Template	78
Length on Template	19
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1760_004

Type	Read
Score	102
Start on Template	14
Length on Template	18
Start on Read	0
Length of Read	22
Unique	Yes
Positional Score
Alignment graphic

C1764_007

Type	Read
Score	95
Start on Template	17
Length on Template	15
Start on Read	0
Length of Read	22
Unique	Yes
Positional Score
Alignment graphic

C1936_003

Type	Read
Score	128
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1948_005

Type	Read
Score	60
Start on Template	192
Length on Template	9
Start on Read	0
Length of Read	9
Unique	Yes
Positional Score
Alignment graphic

Combined_1204

Type	Read
Score	98
Start on Template	87
Length on Template	19
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C2210_002

Type	Read
Score	134
Start on Template	58
Length on Template	19
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C2313

Type	Read
Score	149
Start on Template	76
Length on Template	22
Start on Read	0
Length of Read	25
Unique	Yes
Positional Score
Alignment graphic

C2590

Type	Read
Score	120
Start on Template	77
Length on Template	21
Start on Read	0
Length of Read	25
Unique	Yes
Positional Score
Alignment graphic

C2593_002

Type	Read
Score	143
Start on Template	77
Length on Template	21
Start on Read	0
Length of Read	22
Unique	Yes
Positional Score
Alignment graphic

C2644_002

Type	Read
Score	137
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C2674_002

Type	Read
Score	131
Start on Template	84
Length on Template	20
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

Combined_1288

Type	Read
Score	84
Start on Template	216
Length on Template	15
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

Combined_2973

Type	Read
Score	76
Start on Template	216
Length on Template	14
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

Combined_3784

Type	Read
Score	120
Start on Template	58
Length on Template	19
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_1087

Type	Read
Score	79
Start on Template	146
Length on Template	11
Start on Read	0
Length of Read	11
Unique	Yes
Positional Score
Alignment graphic

C501_004

Type	Read
Score	78
Start on Template	22
Length on Template	10
Start on Read	0
Length of Read	12
Unique	Yes
Positional Score
Alignment graphic

Combined_3826

Type	Read
Score	105
Start on Template	77
Length on Template	14
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

Combined_3463

Type	Read
Score	75
Start on Template	22
Length on Template	10
Start on Read	0
Length of Read	10
Unique	Yes
Positional Score
Alignment graphic

C990_003

Type	Read
Score	137
Start on Template	59
Length on Template	18
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C995_002

Type	Read
Score	128
Start on Template	59
Length on Template	18
Start on Read	0
Length of Read	23
Unique	Yes
Positional Score
Alignment graphic

Combined_1118

Type	Read
Score	104
Start on Template	29
Length on Template	13
Start on Read	0
Length of Read	13
Unique	Yes
Positional Score
Alignment graphic

C1007_002

Type	Read
Score	93
Start on Template	58
Length on Template	19
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1014_002

Type	Read
Score	98
Start on Template	29
Length on Template	13
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

C1015_003

Type	Read
Score	89
Start on Template	29
Length on Template	13
Start on Read	0
Length of Read	12
Unique	Yes
Positional Score
Alignment graphic

C1043_005

Type	Read
Score	90
Start on Template	59
Length on Template	17
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

C1110_002

Type	Read
Score	90
Start on Template	83
Length on Template	14
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

Combined_2472

Type	Read
Score	116
Start on Template	61
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C1143_003

Type	Read
Score	121
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1194_003

Type	Read
Score	93
Start on Template	60
Length on Template	12
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

C1212_003

Type	Read
Score	141
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

C1221_002

Type	Read
Score	107
Start on Template	78
Length on Template	19
Start on Read	0
Length of Read	24
Unique	Yes
Positional Score
Alignment graphic

C1229_006

Type	Read
Score	130
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

Combined_1273

Type	Read
Score	89
Start on Template	78
Length on Template	19
Start on Read	0
Length of Read	19
Unique	No
Positional Score
Alignment graphic

C1260_003

Type	Read
Score	84
Start on Template	133
Length on Template	15
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

Combined_1377

Type	Read
Score	83
Start on Template	220
Length on Template	11
Start on Read	0
Length of Read	11
Unique	Yes
Positional Score
Alignment graphic

Combined_1133

Type	Read
Score	125
Start on Template	77
Length on Template	18
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

Combined_1140

Type	Read
Score	86
Start on Template	91
Length on Template	13
Start on Read	0
Length of Read	13
Unique	Yes
Positional Score
Alignment graphic

C1626_002

Type	Read
Score	140
Start on Template	77
Length on Template	21
Start on Read	0
Length of Read	23
Unique	Yes
Positional Score
Alignment graphic

C1741_004

Type	Read
Score	117
Start on Template	77
Length on Template	21
Start on Read	0
Length of Read	24
Unique	Yes
Positional Score
Alignment graphic

C1791_004

Type	Read
Score	117
Start on Template	84
Length on Template	20
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

Combined_2750

Type	Read
Score	79
Start on Template	214
Length on Template	17
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

Combined_1242

Type	Read
Score	71
Start on Template	96
Length on Template	11
Start on Read	0
Length of Read	12
Unique	Yes
Positional Score
Alignment graphic

C719_003

Type	Read
Score	92
Start on Template	94
Length on Template	13
Start on Read	0
Length of Read	13
Unique	Yes
Positional Score
Alignment graphic

C839_004

Type	Read
Score	89
Start on Template	77
Length on Template	14
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

Combined_1356

Type	Read
Score	106
Start on Template	77
Length on Template	17
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

Combined_1180

Type	Read
Score	131
Start on Template	77
Length on Template	17
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C1426_003

Type	Read
Score	119
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	22
Unique	Yes
Positional Score
Alignment graphic

Combined_3851

Type	Read
Score	120
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1447_004

Type	Read
Score	112
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_1187

Type	Read
Score	105
Start on Template	115
Length on Template	19
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_1466

Type	Read
Score	102
Start on Template	62
Length on Template	15
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

C1508_003

Type	Read
Score	103
Start on Template	55
Length on Template	21
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

Combined_1366

Type	Read
Score	63
Start on Template	34
Length on Template	8
Start on Read	0
Length of Read	9
Unique	Yes
Positional Score
Alignment graphic

Combined_1367

Type	Read
Score	78
Start on Template	32
Length on Template	10
Start on Read	0
Length of Read	12
Unique	Yes
Positional Score
Alignment graphic

Combined_2555

Type	Read
Score	129
Start on Template	77
Length on Template	17
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

C1624_002

Type	Read
Score	123
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_3855

Type	Read
Score	123
Start on Template	60
Length on Template	17
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1794

Type	Read
Score	143
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_1271

Type	Read
Score	135
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

C1844_006

Type	Read
Score	92
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1848_003

Type	Read
Score	136
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

C1890_003

Type	Read
Score	132
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	23
Unique	Yes
Positional Score
Alignment graphic

C1908_005

Type	Read
Score	130
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	24
Unique	Yes
Positional Score
Alignment graphic

C1939_004

Type	Read
Score	101
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C2069_004

Type	Read
Score	102
Start on Template	78
Length on Template	19
Start on Read	0
Length of Read	24
Unique	Yes
Positional Score
Alignment graphic

C2185_002

Type	Read
Score	102
Start on Template	32
Length on Template	21
Start on Read	0
Length of Read	22
Unique	Yes
Positional Score
Alignment graphic

Combined_1212

Type	Read
Score	86
Start on Template	85
Length on Template	13
Start on Read	0
Length of Read	13
Unique	Yes
Positional Score
Alignment graphic

C2325

Type	Read
Score	80
Start on Template	115
Length on Template	14
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

C2383

Type	Read
Score	157
Start on Template	57
Length on Template	22
Start on Read	0
Length of Read	22
Unique	Yes
Positional Score
Alignment graphic

C2397

Type	Read
Score	139
Start on Template	76
Length on Template	23
Start on Read	0
Length of Read	26
Unique	Yes
Positional Score
Alignment graphic

C2405

Type	Read
Score	104
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	13
Unique	Yes
Positional Score
Alignment graphic

C2451

Type	Read
Score	90
Start on Template	85
Length on Template	13
Start on Read	0
Length of Read	13
Unique	Yes
Positional Score
Alignment graphic

Combined_1217

Type	Read
Score	85
Start on Template	133
Length on Template	14
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

C2649_002

Type	Read
Score	119
Start on Template	85
Length on Template	19
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C2775

Type	Read
Score	97
Start on Template	83
Length on Template	15
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

Combined_1498

Type	Read
Score	80
Start on Template	8
Length on Template	10
Start on Read	0
Length of Read	10
Unique	Yes
Positional Score
Alignment graphic

C640_002

Type	Read
Score	59
Start on Template	24
Length on Template	8
Start on Read	0
Length of Read	8
Unique	Yes
Positional Score
Alignment graphic

C875_002

Type	Read
Score	70
Start on Template	57
Length on Template	10
Start on Read	0
Length of Read	10
Unique	Yes
Positional Score
Alignment graphic

C987_007

Type	Read
Score	60
Start on Template	84
Length on Template	10
Start on Read	0
Length of Read	9
Unique	Yes
Positional Score
Alignment graphic

Combined_1260

Type	Read
Score	108
Start on Template	77
Length on Template	17
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

Combined_1360

Type	Read
Score	125
Start on Template	58
Length on Template	19
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1399_005

Type	Read
Score	102
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1428_004

Type	Read
Score	94
Start on Template	58
Length on Template	19
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1450_002

Type	Read
Score	141
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	23
Unique	Yes
Positional Score
Alignment graphic

C1453_002

Type	Read
Score	106
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1456_004

Type	Read
Score	85
Start on Template	29
Length on Template	13
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

C1487_003

Type	Read
Score	83
Start on Template	58
Length on Template	14
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

Combined_1444

Type	Read
Score	76
Start on Template	86
Length on Template	11
Start on Read	0
Length of Read	11
Unique	Yes
Positional Score
Alignment graphic

C1622_005

Type	Read
Score	71
Start on Template	134
Length on Template	9
Start on Read	0
Length of Read	10
Unique	Yes
Positional Score
Alignment graphic

Combined_3873

Type	Read
Score	106
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1676_007

Type	Read
Score	128
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1847_006

Type	Read
Score	97
Start on Template	78
Length on Template	16
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C1860_005

Type	Read
Score	128
Start on Template	78
Length on Template	19
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1945_002

Type	Read
Score	76
Start on Template	133
Length on Template	14
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

C1965_002

Type	Read
Score	139
Start on Template	77
Length on Template	18
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

C2099_002

Type	Read
Score	123
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	23
Unique	Yes
Positional Score
Alignment graphic

C2109

Type	Read
Score	123
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	23
Unique	Yes
Positional Score
Alignment graphic

C2147_003

Type	Read
Score	120
Start on Template	77
Length on Template	18
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C2229_002

Type	Read
Score	107
Start on Template	85
Length on Template	20
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

C2249

Type	Read
Score	92
Start on Template	57
Length on Template	15
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

Combined_1425

Type	Read
Score	123
Start on Template	58
Length on Template	19
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C2433

Type	Read
Score	137
Start on Template	57
Length on Template	22
Start on Read	0
Length of Read	22
Unique	Yes
Positional Score
Alignment graphic

Combined_1383

Type	Read
Score	86
Start on Template	134
Length on Template	12
Start on Read	0
Length of Read	13
Unique	Yes
Positional Score
Alignment graphic

C2904

Type	Read
Score	95
Start on Template	83
Length on Template	15
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C682_003

Type	Read
Score	63
Start on Template	107
Length on Template	8
Start on Read	0
Length of Read	9
Unique	Yes
Positional Score
Alignment graphic

C1142_004

Type	Read
Score	72
Start on Template	214
Length on Template	9
Start on Read	0
Length of Read	9
Unique	Yes
Positional Score
Alignment graphic

C1545

Type	Read
Score	115
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	22
Unique	Yes
Positional Score
Alignment graphic

C1568_005

Type	Read
Score	107
Start on Template	61
Length on Template	16
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

C1589_006

Type	Read
Score	104
Start on Template	115
Length on Template	18
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

C1609_002

Type	Read
Score	82
Start on Template	27
Length on Template	15
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

Combined_1398

Type	Read
Score	108
Start on Template	62
Length on Template	15
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

C1639_006

Type	Read
Score	89
Start on Template	132
Length on Template	15
Start on Read	0
Length of Read	19
Unique	No
Positional Score
Alignment graphic

C1677_002

Type	Read
Score	127
Start on Template	76
Length on Template	21
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

C1697_003

Type	Read
Score	100
Start on Template	79
Length on Template	15
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C1809_003

Type	Read
Score	97
Start on Template	60
Length on Template	17
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_2951

Type	Read
Score	125
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_2565

Type	Read
Score	85
Start on Template	133
Length on Template	14
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

C2066_005

Type	Read
Score	80
Start on Template	134
Length on Template	13
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

C2216

Type	Read
Score	144
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

C768_004

Type	Read
Score	104
Start on Template	94
Length on Template	13
Start on Read	0
Length of Read	13
Unique	Yes
Positional Score
Alignment graphic

Combined_2467

Type	Read
Score	62
Start on Template	18
Length on Template	9
Start on Read	0
Length of Read	9
Unique	Yes
Positional Score
Alignment graphic

Combined_2780

Type	Read
Score	73
Start on Template	220
Length on Template	11
Start on Read	0
Length of Read	13
Unique	No
Positional Score
Alignment graphic

C1583_004

Type	Read
Score	106
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1601_006

Type	Read
Score	127
Start on Template	39
Length on Template	38
Start on Read	0
Length of Read	39
Unique	Yes
Positional Score
Alignment graphic

Combined_2474

Type	Read
Score	115
Start on Template	58
Length on Template	19
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1877_003

Type	Read
Score	111
Start on Template	78
Length on Template	19
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

C1977_003

Type	Read
Score	98
Start on Template	57
Length on Template	15
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C2034_004

Type	Read
Score	107
Start on Template	9
Length on Template	23
Start on Read	0
Length of Read	23
Unique	Yes
Positional Score
Alignment graphic

C2046_003

Type	Read
Score	132
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C2065_002

Type	Read
Score	83
Start on Template	133
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C2207_002

Type	Read
Score	107
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

Combined_2522

Type	Read
Score	76
Start on Template	84
Length on Template	13
Start on Read	0
Length of Read	14
Unique	No
Positional Score
Alignment graphic

C2260_002

Type	Read
Score	121
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	24
Unique	Yes
Positional Score
Alignment graphic

C2335_003

Type	Read
Score	181
Start on Template	57
Length on Template	26
Start on Read	0
Length of Read	28
Unique	Yes
Positional Score
Alignment graphic

C2354_003

Type	Read
Score	95
Start on Template	115
Length on Template	14
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

C2388_004

Type	Read
Score	135
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

Combined_2524

Type	Read
Score	80
Start on Template	27
Length on Template	15
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

C3054_002

Type	Read
Score	124
Start on Template	61
Length on Template	16
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C3250_003

Type	Read
Score	93
Start on Template	85
Length on Template	13
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

Combined_2639

Type	Read
Score	78
Start on Template	97
Length on Template	10
Start on Read	0
Length of Read	12
Unique	Yes
Positional Score
Alignment graphic

Combined_2464

Type	Read
Score	84
Start on Template	57
Length on Template	12
Start on Read	0
Length of Read	12
Unique	Yes
Positional Score
Alignment graphic

C193_009

Type	Read
Score	104
Start on Template	115
Length on Template	18
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C194_006

Type	Read
Score	104
Start on Template	115
Length on Template	18
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C240_007

Type	Read
Score	96
Start on Template	133
Length on Template	12
Start on Read	0
Length of Read	12
Unique	Yes
Positional Score
Alignment graphic

C247_006

Type	Read
Score	97
Start on Template	115
Length on Template	18
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C256_006

Type	Read
Score	132
Start on Template	59
Length on Template	18
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

Combined_1399

Type	Read
Score	78
Start on Template	167
Length on Template	11
Start on Read	0
Length of Read	10
Unique	Yes
Positional Score
Alignment graphic

C280_006

Type	Read
Score	128
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C319_004

Type	Read
Score	98
Start on Template	115
Length on Template	26
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C373_005

Type	Read
Score	107
Start on Template	60
Length on Template	17
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C379_009

Type	Read
Score	129
Start on Template	59
Length on Template	18
Start on Read	0
Length of Read	22
Unique	Yes
Positional Score
Alignment graphic

Combined_3660

Type	Read
Score	97
Start on Template	58
Length on Template	19
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_1407

Type	Read
Score	115
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C435_004

Type	Read
Score	105
Start on Template	97
Length on Template	18
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C437_007

Type	Read
Score	90
Start on Template	133
Length on Template	14
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

C491_006

Type	Read
Score	106
Start on Template	61
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C497_004

Type	Read
Score	97
Start on Template	60
Length on Template	14
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C595_008

Type	Read
Score	86
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	13
Unique	Yes
Positional Score
Alignment graphic

C634_003

Type	Read
Score	121
Start on Template	115
Length on Template	18
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

Combined_1448

Type	Read
Score	89
Start on Template	12
Length on Template	17
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C641_005

Type	Read
Score	133
Start on Template	58
Length on Template	19
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C651_003

Type	Read
Score	99
Start on Template	115
Length on Template	18
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

C666_006

Type	Read
Score	105
Start on Template	115
Length on Template	18
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C670_004

Type	Read
Score	106
Start on Template	55
Length on Template	22
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C686_010

Type	Read
Score	141
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	23
Unique	Yes
Positional Score
Alignment graphic

C695_005

Type	Read
Score	114
Start on Template	54
Length on Template	23
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

C721_004

Type	Read
Score	118
Start on Template	58
Length on Template	19
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

C749_004

Type	Read
Score	122
Start on Template	58
Length on Template	19
Start on Read	0
Length of Read	22
Unique	Yes
Positional Score
Alignment graphic

Combined_3835

Type	Read
Score	110
Start on Template	59
Length on Template	18
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C811_004

Type	Read
Score	95
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

C829_006

Type	Read
Score	104
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

C850_004

Type	Read
Score	112
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

Combined_1410

Type	Read
Score	127
Start on Template	133
Length on Template	17
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

Combined_1537

Type	Read
Score	115
Start on Template	61
Length on Template	16
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C1087_008

Type	Read
Score	108
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

Combined_1502

Type	Read
Score	70
Start on Template	97
Length on Template	10
Start on Read	0
Length of Read	10
Unique	Yes
Positional Score
Alignment graphic

C1214_003

Type	Read
Score	107
Start on Template	76
Length on Template	21
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1267_003

Type	Read
Score	131
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

C1274_004

Type	Read
Score	96
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

C1290_002

Type	Read
Score	119
Start on Template	56
Length on Template	21
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

Combined_1416

Type	Read
Score	121
Start on Template	78
Length on Template	19
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

C221_005

Type	Read
Score	116
Start on Template	115
Length on Template	18
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

C255_011

Type	Read
Score	107
Start on Template	61
Length on Template	16
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C309_007

Type	Read
Score	107
Start on Template	115
Length on Template	19
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

Combined_1481

Type	Read
Score	126
Start on Template	115
Length on Template	18
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

C443_008

Type	Read
Score	107
Start on Template	115
Length on Template	19
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

Combined_1429

Type	Read
Score	70
Start on Template	167
Length on Template	11
Start on Read	0
Length of Read	11
Unique	Yes
Positional Score
Alignment graphic

C614_004

Type	Read
Score	98
Start on Template	57
Length on Template	19
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C673_004

Type	Read
Score	105
Start on Template	61
Length on Template	16
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C678_004

Type	Read
Score	144
Start on Template	133
Length on Template	24
Start on Read	0
Length of Read	25
Unique	Yes
Positional Score
Alignment graphic

C691_009

Type	Read
Score	106
Start on Template	61
Length on Template	16
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_1550

Type	Read
Score	137
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C743_006

Type	Read
Score	115
Start on Template	59
Length on Template	18
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_1411

Type	Read
Score	70
Start on Template	87
Length on Template	11
Start on Read	0
Length of Read	11
Unique	Yes
Positional Score
Alignment graphic

C837_002

Type	Read
Score	98
Start on Template	76
Length on Template	21
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C911_002

Type	Read
Score	137
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C921_006

Type	Read
Score	101
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

C966_007

Type	Read
Score	98
Start on Template	78
Length on Template	19
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1137_002

Type	Read
Score	110
Start on Template	60
Length on Template	17
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1147_003

Type	Read
Score	140
Start on Template	78
Length on Template	19
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

C1219_004

Type	Read
Score	141
Start on Template	59
Length on Template	18
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

C1247_004

Type	Read
Score	110
Start on Template	78
Length on Template	19
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1252_002

Type	Read
Score	140
Start on Template	56
Length on Template	21
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

C1254_007

Type	Read
Score	102
Start on Template	61
Length on Template	16
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

C1258_004

Type	Read
Score	101
Start on Template	218
Length on Template	13
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C1260_004

Type	Read
Score	123
Start on Template	58
Length on Template	19
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

C1285_004

Type	Read
Score	104
Start on Template	50
Length on Template	27
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

C129_010

Type	Read
Score	129
Start on Template	115
Length on Template	18
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C151_007

Type	Read
Score	101
Start on Template	115
Length on Template	23
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C205_008

Type	Read
Score	112
Start on Template	115
Length on Template	18
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

Combined_1423

Type	Read
Score	113
Start on Template	115
Length on Template	18
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

Combined_1441

Type	Read
Score	96
Start on Template	91
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C300_004

Type	Read
Score	105
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

Combined_1443

Type	Read
Score	110
Start on Template	62
Length on Template	15
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

C367_007

Type	Read
Score	130
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_1445

Type	Read
Score	124
Start on Template	58
Length on Template	19
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C500_007

Type	Read
Score	119
Start on Template	58
Length on Template	19
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_1447

Type	Read
Score	138
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	22
Unique	Yes
Positional Score
Alignment graphic

Combined_2668

Type	Read
Score	97
Start on Template	59
Length on Template	18
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C665_007

Type	Read
Score	98
Start on Template	83
Length on Template	14
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

C898_003

Type	Read
Score	126
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

Combined_1510

Type	Read
Score	151
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	22
Unique	Yes
Positional Score
Alignment graphic

C940_003

Type	Read
Score	110
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C966_008

Type	Read
Score	139
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C986_003

Type	Read
Score	106
Start on Template	75
Length on Template	22
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

Combined_3123

Type	Read
Score	120
Start on Template	216
Length on Template	15
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

Combined_3662

Type	Read
Score	138
Start on Template	55
Length on Template	22
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

C1049_003

Type	Read
Score	138
Start on Template	56
Length on Template	21
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

C1118_004

Type	Read
Score	111
Start on Template	62
Length on Template	15
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

Combined_1491

Type	Read
Score	133
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_1479

Type	Read
Score	56
Start on Template	90
Length on Template	7
Start on Read	0
Length of Read	7
Unique	No
Positional Score
Alignment graphic

C310_006

Type	Read
Score	97
Start on Template	115
Length on Template	18
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C334_007

Type	Read
Score	105
Start on Template	115
Length on Template	18
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

Combined_1482

Type	Read
Score	123
Start on Template	115
Length on Template	18
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C360_006

Type	Read
Score	102
Start on Template	111
Length on Template	23
Start on Read	0
Length of Read	24
Unique	Yes
Positional Score
Alignment graphic

Combined_1442

Type	Read
Score	109
Start on Template	115
Length on Template	17
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C402_007

Type	Read
Score	102
Start on Template	62
Length on Template	15
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

C558_003

Type	Read
Score	101
Start on Template	91
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C559_006

Type	Read
Score	114
Start on Template	78
Length on Template	19
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C661_004

Type	Read
Score	102
Start on Template	62
Length on Template	15
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C680_006

Type	Read
Score	87
Start on Template	84
Length on Template	13
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

C732_003

Type	Read
Score	109
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C843_005

Type	Read
Score	103
Start on Template	91
Length on Template	14
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

Combined_1451

Type	Read
Score	124
Start on Template	60
Length on Template	17
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1271_006

Type	Read
Score	123
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

C239_011

Type	Read
Score	76
Start on Template	18
Length on Template	11
Start on Read	0
Length of Read	11
Unique	Yes
Positional Score
Alignment graphic

C246_009

Type	Read
Score	100
Start on Template	115
Length on Template	24
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C312_008

Type	Read
Score	135
Start on Template	115
Length on Template	18
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

Combined_1464

Type	Read
Score	99
Start on Template	115
Length on Template	18
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

C377_008

Type	Read
Score	86
Start on Template	115
Length on Template	18
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C399_010

Type	Read
Score	118
Start on Template	29
Length on Template	24
Start on Read	0
Length of Read	23
Unique	Yes
Positional Score
Alignment graphic

C409_005

Type	Read
Score	128
Start on Template	28
Length on Template	23
Start on Read	0
Length of Read	22
Unique	Yes
Positional Score
Alignment graphic

C414_006

Type	Read
Score	90
Start on Template	115
Length on Template	18
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

C477_009

Type	Read
Score	97
Start on Template	58
Length on Template	19
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_2729

Type	Read
Score	155
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C531_003

Type	Read
Score	95
Start on Template	91
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C643_006

Type	Read
Score	96
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C741_006

Type	Read
Score	93
Start on Template	85
Length on Template	23
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

C746_003

Type	Read
Score	106
Start on Template	87
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_2486

Type	Read
Score	94
Start on Template	85
Length on Template	12
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

C1262_002

Type	Read
Score	126
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

Combined_1493

Type	Read
Score	117
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

C171_012

Type	Read
Score	121
Start on Template	115
Length on Template	18
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C189_011

Type	Read
Score	101
Start on Template	115
Length on Template	18
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C195_009

Type	Read
Score	139
Start on Template	115
Length on Template	18
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C200_009

Type	Read
Score	114
Start on Template	115
Length on Template	23
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C220_012

Type	Read
Score	99
Start on Template	115
Length on Template	18
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

C238_012

Type	Read
Score	116
Start on Template	61
Length on Template	16
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

Combined_1507

Type	Read
Score	88
Start on Template	167
Length on Template	11
Start on Read	0
Length of Read	11
Unique	Yes
Positional Score
Alignment graphic

C280_007

Type	Read
Score	101
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C399_011

Type	Read
Score	102
Start on Template	62
Length on Template	15
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

C414_007

Type	Read
Score	87
Start on Template	85
Length on Template	12
Start on Read	0
Length of Read	12
Unique	Yes
Positional Score
Alignment graphic

C566_005

Type	Read
Score	112
Start on Template	115
Length on Template	18
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C579_004

Type	Read
Score	124
Start on Template	61
Length on Template	16
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_1489

Type	Read
Score	151
Start on Template	159
Length on Template	19
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_2800

Type	Read
Score	105
Start on Template	61
Length on Template	16
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

C753_005

Type	Read
Score	131
Start on Template	147
Length on Template	31
Start on Read	0
Length of Read	31
Unique	Yes
Positional Score
Alignment graphic

C900_004

Type	Read
Score	133
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1054_003

Type	Read
Score	120
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

C1121_004

Type	Read
Score	147
Start on Template	78
Length on Template	19
Start on Read	0
Length of Read	22
Unique	Yes
Positional Score
Alignment graphic

C1138_005

Type	Read
Score	115
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1151_004

Type	Read
Score	111
Start on Template	56
Length on Template	21
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1189_003

Type	Read
Score	132
Start on Template	59
Length on Template	18
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

C1234_006

Type	Read
Score	109
Start on Template	76
Length on Template	21
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

C1267_004

Type	Read
Score	116
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C53_008

Type	Read
Score	79
Start on Template	97
Length on Template	10
Start on Read	0
Length of Read	11
Unique	Yes
Positional Score
Alignment graphic

Combined_1505

Type	Read
Score	88
Start on Template	18
Length on Template	11
Start on Read	0
Length of Read	11
Unique	Yes
Positional Score
Alignment graphic

C433_008

Type	Read
Score	107
Start on Template	61
Length on Template	16
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C444_006

Type	Read
Score	130
Start on Template	59
Length on Template	18
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

Combined_1484

Type	Read
Score	115
Start on Template	58
Length on Template	19
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C553_004

Type	Read
Score	135
Start on Template	115
Length on Template	18
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

C556_009

Type	Read
Score	142
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C564_006

Type	Read
Score	94
Start on Template	133
Length on Template	14
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

C565_003

Type	Read
Score	133
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C602_005

Type	Read
Score	87
Start on Template	115
Length on Template	18
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

C662_005

Type	Read
Score	96
Start on Template	135
Length on Template	12
Start on Read	0
Length of Read	12
Unique	Yes
Positional Score
Alignment graphic

C688_003

Type	Read
Score	78
Start on Template	85
Length on Template	12
Start on Read	0
Length of Read	12
Unique	Yes
Positional Score
Alignment graphic

C708_004

Type	Read
Score	65
Start on Template	87
Length on Template	10
Start on Read	0
Length of Read	10
Unique	Yes
Positional Score
Alignment graphic

C725_004

Type	Read
Score	116
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_1509

Type	Read
Score	112
Start on Template	78
Length on Template	19
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

C752_006

Type	Read
Score	92
Start on Template	91
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C817_005

Type	Read
Score	86
Start on Template	136
Length on Template	11
Start on Read	0
Length of Read	13
Unique	Yes
Positional Score
Alignment graphic

C942_006

Type	Read
Score	110
Start on Template	90
Length on Template	17
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C1268_007

Type	Read
Score	73
Start on Template	219
Length on Template	12
Start on Read	0
Length of Read	12
Unique	Yes
Positional Score
Alignment graphic

Combined_1710

Type	Read
Score	92
Start on Template	85
Length on Template	12
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

Combined_1641

Type	Read
Score	106
Start on Template	115
Length on Template	18
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

Combined_1506

Type	Read
Score	70
Start on Template	135
Length on Template	10
Start on Read	0
Length of Read	11
Unique	Yes
Positional Score
Alignment graphic

C494_007

Type	Read
Score	116
Start on Template	115
Length on Template	18
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

C546_008

Type	Read
Score	93
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C583_005

Type	Read
Score	89
Start on Template	61
Length on Template	16
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C602_006

Type	Read
Score	97
Start on Template	60
Length on Template	14
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C612_004

Type	Read
Score	78
Start on Template	85
Length on Template	12
Start on Read	0
Length of Read	12
Unique	Yes
Positional Score
Alignment graphic

C710_008

Type	Read
Score	99
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C721_006

Type	Read
Score	106
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C820_004

Type	Read
Score	139
Start on Template	133
Length on Template	24
Start on Read	0
Length of Read	25
Unique	Yes
Positional Score
Alignment graphic

C846_003

Type	Read
Score	122
Start on Template	90
Length on Template	17
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C901_003

Type	Read
Score	124
Start on Template	59
Length on Template	18
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C954_002

Type	Read
Score	101
Start on Template	135
Length on Template	15
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C979_006

Type	Read
Score	140
Start on Template	78
Length on Template	19
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

C1040_005

Type	Read
Score	110
Start on Template	160
Length on Template	18
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1154_003

Type	Read
Score	91
Start on Template	84
Length on Template	13
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

Combined_1797

Type	Read
Score	98
Start on Template	84
Length on Template	13
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

C1376_005

Type	Read
Score	119
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C1395

Type	Read
Score	141
Start on Template	58
Length on Template	19
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

C1462_004

Type	Read
Score	115
Start on Template	61
Length on Template	16
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_1496

Type	Read
Score	64
Start on Template	99
Length on Template	8
Start on Read	0
Length of Read	8
Unique	Yes
Positional Score
Alignment graphic

C454_006

Type	Read
Score	114
Start on Template	115
Length on Template	18
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C509_005

Type	Read
Score	127
Start on Template	30
Length on Template	24
Start on Read	0
Length of Read	24
Unique	Yes
Positional Score
Alignment graphic

C546_009

Type	Read
Score	116
Start on Template	115
Length on Template	18
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C547_004

Type	Read
Score	84
Start on Template	133
Length on Template	15
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

C549_007

Type	Read
Score	106
Start on Template	115
Length on Template	18
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C664_007

Type	Read
Score	78
Start on Template	85
Length on Template	12
Start on Read	0
Length of Read	12
Unique	Yes
Positional Score
Alignment graphic

C711_002

Type	Read
Score	113
Start on Template	78
Length on Template	19
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

C790_004

Type	Read
Score	98
Start on Template	133
Length on Template	14
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

C795_007

Type	Read
Score	73
Start on Template	85
Length on Template	12
Start on Read	0
Length of Read	12
Unique	Yes
Positional Score
Alignment graphic

Combined_1681

Type	Read
Score	135
Start on Template	133
Length on Template	24
Start on Read	0
Length of Read	25
Unique	Yes
Positional Score
Alignment graphic

C911_004

Type	Read
Score	137
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C957_002

Type	Read
Score	93
Start on Template	85
Length on Template	23
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

C1029_004

Type	Read
Score	100
Start on Template	58
Length on Template	19
Start on Read	0
Length of Read	22
Unique	Yes
Positional Score
Alignment graphic

C1078_005

Type	Read
Score	98
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

C1379_008

Type	Read
Score	166
Start on Template	83
Length on Template	24
Start on Read	0
Length of Read	24
Unique	Yes
Positional Score
Alignment graphic

Combined_2483

Type	Read
Score	92
Start on Template	85
Length on Template	12
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

C1441_004

Type	Read
Score	141
Start on Template	58
Length on Template	19
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

C1465_004

Type	Read
Score	115
Start on Template	61
Length on Template	16
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1518_003

Type	Read
Score	133
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1530_003

Type	Read
Score	132
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

C476_009

Type	Read
Score	76
Start on Template	39
Length on Template	14
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

C1108_002

Type	Read
Score	91
Start on Template	115
Length on Template	18
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C1118_005

Type	Read
Score	103
Start on Template	115
Length on Template	18
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

C1124_005

Type	Read
Score	99
Start on Template	115
Length on Template	18
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

C1208_003

Type	Read
Score	89
Start on Template	61
Length on Template	16
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C1348_003

Type	Read
Score	114
Start on Template	59
Length on Template	18
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1356_005

Type	Read
Score	117
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	22
Unique	Yes
Positional Score
Alignment graphic

C1394_006

Type	Read
Score	115
Start on Template	115
Length on Template	18
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

Combined_1659

Type	Read
Score	111
Start on Template	62
Length on Template	15
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

C1443_009

Type	Read
Score	143
Start on Template	29
Length on Template	22
Start on Read	0
Length of Read	23
Unique	Yes
Positional Score
Alignment graphic

Combined_3651

Type	Read
Score	128
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1506_005

Type	Read
Score	83
Start on Template	61
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C1634_005

Type	Read
Score	97
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1791_005

Type	Read
Score	87
Start on Template	84
Length on Template	13
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

Combined_2667

Type	Read
Score	103
Start on Template	133
Length on Template	14
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

C1807_005

Type	Read
Score	144
Start on Template	133
Length on Template	24
Start on Read	0
Length of Read	25
Unique	Yes
Positional Score
Alignment graphic

C2004_005

Type	Read
Score	94
Start on Template	83
Length on Template	14
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

C2027_003

Type	Read
Score	159
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

C2143_002

Type	Read
Score	144
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

C2378_003

Type	Read
Score	123
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C2445_003

Type	Read
Score	138
Start on Template	78
Length on Template	19
Start on Read	0
Length of Read	22
Unique	Yes
Positional Score
Alignment graphic

C1142_008

Type	Read
Score	98
Start on Template	115
Length on Template	19
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C1309_004

Type	Read
Score	103
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1344_003

Type	Read
Score	81
Start on Template	85
Length on Template	12
Start on Read	0
Length of Read	12
Unique	Yes
Positional Score
Alignment graphic

C1394_007

Type	Read
Score	114
Start on Template	115
Length on Template	18
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C1434_002

Type	Read
Score	111
Start on Template	62
Length on Template	15
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C1435_003

Type	Read
Score	87
Start on Template	97
Length on Template	18
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C1458_003

Type	Read
Score	85
Start on Template	62
Length on Template	14
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

C1515_006

Type	Read
Score	78
Start on Template	135
Length on Template	12
Start on Read	0
Length of Read	12
Unique	Yes
Positional Score
Alignment graphic

C1530_004

Type	Read
Score	79
Start on Template	167
Length on Template	11
Start on Read	0
Length of Read	11
Unique	Yes
Positional Score
Alignment graphic

C1541_003

Type	Read
Score	115
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1728_007

Type	Read
Score	98
Start on Template	134
Length on Template	13
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

C1786_005

Type	Read
Score	95
Start on Template	83
Length on Template	14
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

C1798_004

Type	Read
Score	85
Start on Template	133
Length on Template	14
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

C1832_005

Type	Read
Score	128
Start on Template	57
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C1883_007

Type	Read
Score	115
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1893_008

Type	Read
Score	80
Start on Template	133
Length on Template	14
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

C2062_003

Type	Read
Score	124
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C2244_002

Type	Read
Score	119
Start on Template	78
Length on Template	19
Start on Read	0
Length of Read	22
Unique	Yes
Positional Score
Alignment graphic

C2384

Type	Read
Score	105
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	22
Unique	Yes
Positional Score
Alignment graphic

C2471_002

Type	Read
Score	112
Start on Template	60
Length on Template	17
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C59_008

Type	Read
Score	60
Start on Template	98
Length on Template	9
Start on Read	0
Length of Read	9
Unique	No
Positional Score
Alignment graphic

C1135_004

Type	Read
Score	89
Start on Template	115
Length on Template	19
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C1239_005

Type	Read
Score	142
Start on Template	58
Length on Template	19
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C1287_005

Type	Read
Score	123
Start on Template	115
Length on Template	18
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

C1305_003

Type	Read
Score	84
Start on Template	85
Length on Template	12
Start on Read	0
Length of Read	12
Unique	Yes
Positional Score
Alignment graphic

C1456_006

Type	Read
Score	91
Start on Template	98
Length on Template	17
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

Combined_3128

Type	Read
Score	121
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1540_006

Type	Read
Score	110
Start on Template	61
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C1566_003

Type	Read
Score	73
Start on Template	85
Length on Template	12
Start on Read	0
Length of Read	12
Unique	Yes
Positional Score
Alignment graphic

C1726_008

Type	Read
Score	101
Start on Template	78
Length on Template	19
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_2949

Type	Read
Score	85
Start on Template	133
Length on Template	14
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

C1830_003

Type	Read
Score	84
Start on Template	133
Length on Template	15
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

C1937_006

Type	Read
Score	99
Start on Template	87
Length on Template	20
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C2085_003

Type	Read
Score	140
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

C2302_004

Type	Read
Score	89
Start on Template	85
Length on Template	12
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

C2451_002

Type	Read
Score	115
Start on Template	70
Length on Template	27
Start on Read	0
Length of Read	22
Unique	Yes
Positional Score
Alignment graphic

C2513

Type	Read
Score	97
Start on Template	60
Length on Template	17
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1482_006

Type	Read
Score	77
Start on Template	33
Length on Template	12
Start on Read	0
Length of Read	12
Unique	Yes
Positional Score
Alignment graphic

C1747_007

Type	Read
Score	85
Start on Template	33
Length on Template	15
Start on Read	0
Length of Read	15
Unique	No
Positional Score
Alignment graphic

Combined_1822

Type	Read
Score	75
Start on Template	33
Length on Template	14
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

C989_006

Type	Read
Score	79
Start on Template	32
Length on Template	15
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

C867_005

Type	Read
Score	71
Start on Template	221
Length on Template	10
Start on Read	0
Length of Read	10
Unique	Yes
Positional Score
Alignment graphic

C2177_003

Type	Read
Score	83
Start on Template	215
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C1417_007

Type	Read
Score	83
Start on Template	215
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

Combined_2005

Type	Read
Score	74
Start on Template	220
Length on Template	11
Start on Read	0
Length of Read	11
Unique	Yes
Positional Score
Alignment graphic

Combined_2544

Type	Read
Score	80
Start on Template	157
Length on Template	10
Start on Read	0
Length of Read	10
Unique	Yes
Positional Score
Alignment graphic

Combined_2461

Type	Read
Score	77
Start on Template	76
Length on Template	11
Start on Read	0
Length of Read	13
Unique	Yes
Positional Score
Alignment graphic

Combined_2499

Type	Read
Score	71
Start on Template	87
Length on Template	10
Start on Read	0
Length of Read	10
Unique	Yes
Positional Score
Alignment graphic

C588_010

Type	Read
Score	77
Start on Template	30
Length on Template	12
Start on Read	0
Length of Read	13
Unique	Yes
Positional Score
Alignment graphic

C620_013

Type	Read
Score	113
Start on Template	60
Length on Template	17
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

Combined_2503

Type	Read
Score	64
Start on Template	87
Length on Template	8
Start on Read	0
Length of Read	8
Unique	Yes
Positional Score
Alignment graphic

Combined_2504

Type	Read
Score	64
Start on Template	219
Length on Template	8
Start on Read	0
Length of Read	8
Unique	Yes
Positional Score
Alignment graphic

Combined_2505

Type	Read
Score	115
Start on Template	61
Length on Template	16
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

Combined_2506

Type	Read
Score	124
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_2508

Type	Read
Score	124
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C846_006

Type	Read
Score	83
Start on Template	98
Length on Template	17
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

Combined_2509

Type	Read
Score	91
Start on Template	219
Length on Template	12
Start on Read	0
Length of Read	13
Unique	Yes
Positional Score
Alignment graphic

C893_013

Type	Read
Score	124
Start on Template	59
Length on Template	18
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C986_007

Type	Read
Score	101
Start on Template	61
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

Combined_2513

Type	Read
Score	119
Start on Template	61
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C1027_010

Type	Read
Score	78
Start on Template	61
Length on Template	11
Start on Read	0
Length of Read	11
Unique	Yes
Positional Score
Alignment graphic

Combined_2515

Type	Read
Score	92
Start on Template	61
Length on Template	13
Start on Read	0
Length of Read	13
Unique	Yes
Positional Score
Alignment graphic

Combined_2665

Type	Read
Score	107
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

C1204_008

Type	Read
Score	86
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	13
Unique	Yes
Positional Score
Alignment graphic

C1233_007

Type	Read
Score	98
Start on Template	61
Length on Template	16
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C1299_009

Type	Read
Score	110
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	22
Unique	Yes
Positional Score
Alignment graphic

Combined_3086

Type	Read
Score	131
Start on Template	60
Length on Template	17
Start on Read	0
Length of Read	22
Unique	Yes
Positional Score
Alignment graphic

C1407_008

Type	Read
Score	103
Start on Template	59
Length on Template	18
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_2519

Type	Read
Score	132
Start on Template	59
Length on Template	18
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1530_006

Type	Read
Score	88
Start on Template	87
Length on Template	11
Start on Read	0
Length of Read	11
Unique	Yes
Positional Score
Alignment graphic

C1667_007

Type	Read
Score	96
Start on Template	85
Length on Template	21
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

C1799_006

Type	Read
Score	100
Start on Template	87
Length on Template	17
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C1812_009

Type	Read
Score	142
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_2566

Type	Read
Score	74
Start on Template	87
Length on Template	11
Start on Read	0
Length of Read	11
Unique	Yes
Positional Score
Alignment graphic

C2398_003

Type	Read
Score	130
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_3797

Type	Read
Score	88
Start on Template	37
Length on Template	11
Start on Read	0
Length of Read	11
Unique	Yes
Positional Score
Alignment graphic

C539_011

Type	Read
Score	140
Start on Template	58
Length on Template	19
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

Combined_3085

Type	Read
Score	111
Start on Template	58
Length on Template	19
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_3785

Type	Read
Score	124
Start on Template	58
Length on Template	19
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C760_010

Type	Read
Score	71
Start on Template	88
Length on Template	9
Start on Read	0
Length of Read	10
Unique	Yes
Positional Score
Alignment graphic

C774_011

Type	Read
Score	101
Start on Template	59
Length on Template	18
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C793_009

Type	Read
Score	124
Start on Template	59
Length on Template	18
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C880_004

Type	Read
Score	101
Start on Template	61
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

Combined_3082

Type	Read
Score	119
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1098_006

Type	Read
Score	87
Start on Template	133
Length on Template	28
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C1108_007

Type	Read
Score	111
Start on Template	59
Length on Template	18
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C1142_011

Type	Read
Score	79
Start on Template	133
Length on Template	15
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

C1204_009

Type	Read
Score	114
Start on Template	78
Length on Template	19
Start on Read	0
Length of Read	22
Unique	Yes
Positional Score
Alignment graphic

Combined_3021

Type	Read
Score	94
Start on Template	78
Length on Template	19
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1243_004

Type	Read
Score	101
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1260_007

Type	Read
Score	121
Start on Template	60
Length on Template	17
Start on Read	0
Length of Read	22
Unique	Yes
Positional Score
Alignment graphic

Combined_2615

Type	Read
Score	115
Start on Template	87
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1413_007

Type	Read
Score	161
Start on Template	57
Length on Template	26
Start on Read	0
Length of Read	27
Unique	Yes
Positional Score
Alignment graphic

Combined_3791

Type	Read
Score	114
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	22
Unique	Yes
Positional Score
Alignment graphic

C1454_004

Type	Read
Score	117
Start on Template	60
Length on Template	17
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1460_007

Type	Read
Score	98
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

C1635_005

Type	Read
Score	129
Start on Template	59
Length on Template	18
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

Combined_3033

Type	Read
Score	127
Start on Template	57
Length on Template	28
Start on Read	0
Length of Read	27
Unique	Yes
Positional Score
Alignment graphic

C1875_007

Type	Read
Score	108
Start on Template	58
Length on Template	19
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C93_012

Type	Read
Score	68
Start on Template	147
Length on Template	10
Start on Read	0
Length of Read	10
Unique	Yes
Positional Score
Alignment graphic

Combined_2709

Type	Read
Score	74
Start on Template	95
Length on Template	12
Start on Read	0
Length of Read	13
Unique	Yes
Positional Score
Alignment graphic

C827_013

Type	Read
Score	133
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C913_007

Type	Read
Score	120
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C923_009

Type	Read
Score	101
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_3127

Type	Read
Score	133
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_2845

Type	Read
Score	132
Start on Template	58
Length on Template	19
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1010_007

Type	Read
Score	102
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1019_004

Type	Read
Score	101
Start on Template	61
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

Combined_3009

Type	Read
Score	124
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_2943

Type	Read
Score	115
Start on Template	97
Length on Template	18
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C1093_008

Type	Read
Score	64
Start on Template	18
Length on Template	8
Start on Read	0
Length of Read	8
Unique	Yes
Positional Score
Alignment graphic

C1125_013

Type	Read
Score	112
Start on Template	59
Length on Template	18
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1176_008

Type	Read
Score	77
Start on Template	85
Length on Template	12
Start on Read	0
Length of Read	13
Unique	Yes
Positional Score
Alignment graphic

Combined_2608

Type	Read
Score	87
Start on Template	61
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

Combined_3639

Type	Read
Score	76
Start on Template	61
Length on Template	11
Start on Read	0
Length of Read	11
Unique	Yes
Positional Score
Alignment graphic

C1343_014

Type	Read
Score	102
Start on Template	58
Length on Template	19
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1445_006

Type	Read
Score	94
Start on Template	83
Length on Template	14
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

C1519_007

Type	Read
Score	105
Start on Template	10
Length on Template	22
Start on Read	0
Length of Read	25
Unique	Yes
Positional Score
Alignment graphic

C1551_009

Type	Read
Score	126
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

C1579_006

Type	Read
Score	131
Start on Template	60
Length on Template	17
Start on Read	0
Length of Read	22
Unique	Yes
Positional Score
Alignment graphic

C1618_008

Type	Read
Score	117
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

Combined_2956

Type	Read
Score	87
Start on Template	84
Length on Template	13
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

C1727_005

Type	Read
Score	171
Start on Template	57
Length on Template	26
Start on Read	0
Length of Read	28
Unique	Yes
Positional Score
Alignment graphic

C1975_008

Type	Read
Score	95
Start on Template	85
Length on Template	20
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C2006_006

Type	Read
Score	114
Start on Template	78
Length on Template	19
Start on Read	0
Length of Read	22
Unique	Yes
Positional Score
Alignment graphic

C347_013

Type	Read
Score	79
Start on Template	66
Length on Template	11
Start on Read	0
Length of Read	11
Unique	Yes
Positional Score
Alignment graphic

Combined_2640

Type	Read
Score	75
Start on Template	77
Length on Template	10
Start on Read	0
Length of Read	10
Unique	Yes
Positional Score
Alignment graphic

C392_020

Type	Read
Score	73
Start on Template	97
Length on Template	10
Start on Read	0
Length of Read	12
Unique	Yes
Positional Score
Alignment graphic

Combined_2651

Type	Read
Score	72
Start on Template	57
Length on Template	9
Start on Read	0
Length of Read	9
Unique	Yes
Positional Score
Alignment graphic

C1108_008

Type	Read
Score	68
Start on Template	133
Length on Template	10
Start on Read	0
Length of Read	10
Unique	Yes
Positional Score
Alignment graphic

Combined_2657

Type	Read
Score	142
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_2939

Type	Read
Score	124
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_2941

Type	Read
Score	97
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1184_009

Type	Read
Score	119
Start on Template	58
Length on Template	19
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_3079

Type	Read
Score	103
Start on Template	97
Length on Template	18
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

Combined_2659

Type	Read
Score	82
Start on Template	30
Length on Template	12
Start on Read	0
Length of Read	12
Unique	Yes
Positional Score
Alignment graphic

C1364_009

Type	Read
Score	128
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_2662

Type	Read
Score	110
Start on Template	61
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C1473_003

Type	Read
Score	107
Start on Template	60
Length on Template	16
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C1520_008

Type	Read
Score	97
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1530_007

Type	Read
Score	91
Start on Template	74
Length on Template	23
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C1726_010

Type	Read
Score	85
Start on Template	133
Length on Template	30
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C1752_006

Type	Read
Score	104
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C1755_005

Type	Read
Score	75
Start on Template	133
Length on Template	14
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

Combined_2955

Type	Read
Score	81
Start on Template	220
Length on Template	11
Start on Read	0
Length of Read	12
Unique	Yes
Positional Score
Alignment graphic

C1877_008

Type	Read
Score	98
Start on Template	78
Length on Template	19
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_2740

Type	Read
Score	135
Start on Template	78
Length on Template	19
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

C176_016

Type	Read
Score	79
Start on Template	97
Length on Template	10
Start on Read	0
Length of Read	11
Unique	Yes
Positional Score
Alignment graphic

C659_007

Type	Read
Score	72
Start on Template	91
Length on Template	16
Start on Read	0
Length of Read	12
Unique	Yes
Positional Score
Alignment graphic

C1223_006

Type	Read
Score	106
Start on Template	61
Length on Template	16
Start on Read	0
Length of Read	22
Unique	Yes
Positional Score
Alignment graphic

C1373_011

Type	Read
Score	114
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_2725

Type	Read
Score	93
Start on Template	97
Length on Template	18
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

Combined_2848

Type	Read
Score	115
Start on Template	59
Length on Template	18
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1844_011

Type	Read
Score	84
Start on Template	133
Length on Template	15
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

C1949_007

Type	Read
Score	113
Start on Template	60
Length on Template	17
Start on Read	0
Length of Read	22
Unique	Yes
Positional Score
Alignment graphic

C2112_004

Type	Read
Score	130
Start on Template	57
Length on Template	26
Start on Read	0
Length of Read	28
Unique	Yes
Positional Score
Alignment graphic

C2383_004

Type	Read
Score	98
Start on Template	30
Length on Template	15
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

C908_009

Type	Read
Score	71
Start on Template	87
Length on Template	10
Start on Read	0
Length of Read	10
Unique	Yes
Positional Score
Alignment graphic

C1190_015

Type	Read
Score	106
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1196_010

Type	Read
Score	115
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_2794

Type	Read
Score	142
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1498_006

Type	Read
Score	104
Start on Template	78
Length on Template	16
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

Combined_3013

Type	Read
Score	70
Start on Template	29
Length on Template	10
Start on Read	0
Length of Read	11
Unique	Yes
Positional Score
Alignment graphic

Combined_2947

Type	Read
Score	107
Start on Template	61
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C1506_007

Type	Read
Score	95
Start on Template	59
Length on Template	18
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C1662_009

Type	Read
Score	114
Start on Template	76
Length on Template	21
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

Combined_3800

Type	Read
Score	89
Start on Template	78
Length on Template	19
Start on Read	0
Length of Read	19
Unique	No
Positional Score
Alignment graphic

C1895_010

Type	Read
Score	131
Start on Template	60
Length on Template	17
Start on Read	0
Length of Read	22
Unique	Yes
Positional Score
Alignment graphic

C2328_003

Type	Read
Score	116
Start on Template	58
Length on Template	27
Start on Read	0
Length of Read	28
Unique	Yes
Positional Score
Alignment graphic

C2440_003

Type	Read
Score	94
Start on Template	85
Length on Template	12
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

C2722_002

Type	Read
Score	111
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C175_015

Type	Read
Score	88
Start on Template	66
Length on Template	11
Start on Read	0
Length of Read	11
Unique	Yes
Positional Score
Alignment graphic

Combined_3831

Type	Read
Score	96
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1057_011

Type	Read
Score	115
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1058_009

Type	Read
Score	124
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1092_007

Type	Read
Score	129
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_2847

Type	Read
Score	97
Start on Template	97
Length on Template	18
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C1170_008

Type	Read
Score	115
Start on Template	59
Length on Template	18
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1261_009

Type	Read
Score	133
Start on Template	58
Length on Template	19
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1563_010

Type	Read
Score	124
Start on Template	58
Length on Template	19
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1569_007

Type	Read
Score	114
Start on Template	58
Length on Template	19
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

C1621_006

Type	Read
Score	122
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C1639_008

Type	Read
Score	121
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

Combined_3836

Type	Read
Score	107
Start on Template	61
Length on Template	16
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C1717_008

Type	Read
Score	115
Start on Template	59
Length on Template	18
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1751_006

Type	Read
Score	121
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	24
Unique	Yes
Positional Score
Alignment graphic

Combined_3024

Type	Read
Score	76
Start on Template	134
Length on Template	13
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

C2335_006

Type	Read
Score	85
Start on Template	133
Length on Template	14
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

C2554_005

Type	Read
Score	114
Start on Template	61
Length on Template	16
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

C751_012

Type	Read
Score	80
Start on Template	64
Length on Template	10
Start on Read	0
Length of Read	10
Unique	Yes
Positional Score
Alignment graphic

C1384_007

Type	Read
Score	107
Start on Template	115
Length on Template	19
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C1400_009

Type	Read
Score	115
Start on Template	59
Length on Template	18
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1771_011

Type	Read
Score	121
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

C1986_004

Type	Read
Score	85
Start on Template	134
Length on Template	13
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

C2094_004

Type	Read
Score	113
Start on Template	87
Length on Template	19
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C2140_008

Type	Read
Score	70
Start on Template	87
Length on Template	11
Start on Read	0
Length of Read	11
Unique	Yes
Positional Score
Alignment graphic

C2289_004

Type	Read
Score	135
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

Combined_2918

Type	Read
Score	56
Start on Template	57
Length on Template	7
Start on Read	0
Length of Read	7
Unique	Yes
Positional Score
Alignment graphic

C1339_011

Type	Read
Score	124
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1347_007

Type	Read
Score	125
Start on Template	57
Length on Template	19
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C1425_009

Type	Read
Score	116
Start on Template	58
Length on Template	19
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1735_011

Type	Read
Score	98
Start on Template	63
Length on Template	14
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C1342_011

Type	Read
Score	82
Start on Template	57
Length on Template	15
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

Combined_3010

Type	Read
Score	124
Start on Template	115
Length on Template	18
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C1548_009

Type	Read
Score	97
Start on Template	60
Length on Template	17
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1610_008

Type	Read
Score	107
Start on Template	55
Length on Template	22
Start on Read	0
Length of Read	23
Unique	Yes
Positional Score
Alignment graphic

C1670_009

Type	Read
Score	133
Start on Template	78
Length on Template	19
Start on Read	0
Length of Read	22
Unique	Yes
Positional Score
Alignment graphic

Combined_3015

Type	Read
Score	78
Start on Template	167
Length on Template	11
Start on Read	0
Length of Read	11
Unique	Yes
Positional Score
Alignment graphic

Combined_3084

Type	Read
Score	84
Start on Template	133
Length on Template	15
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

C2087_007

Type	Read
Score	172
Start on Template	58
Length on Template	25
Start on Read	0
Length of Read	28
Unique	Yes
Positional Score
Alignment graphic

C2133_006

Type	Read
Score	140
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

C2284_004

Type	Read
Score	131
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

C2601_005

Type	Read
Score	133
Start on Template	60
Length on Template	17
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1350_013

Type	Read
Score	94
Start on Template	62
Length on Template	15
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

Combined_3080

Type	Read
Score	100
Start on Template	57
Length on Template	17
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C1822_007

Type	Read
Score	74
Start on Template	220
Length on Template	11
Start on Read	0
Length of Read	11
Unique	Yes
Positional Score
Alignment graphic

C1962_012

Type	Read
Score	119
Start on Template	60
Length on Template	17
Start on Read	0
Length of Read	22
Unique	Yes
Positional Score
Alignment graphic

C2031_006

Type	Read
Score	85
Start on Template	133
Length on Template	14
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

C2047_003

Type	Read
Score	76
Start on Template	84
Length on Template	13
Start on Read	0
Length of Read	14
Unique	No
Positional Score
Alignment graphic

C2089_007

Type	Read
Score	115
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C2095_008

Type	Read
Score	115
Start on Template	87
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C2116_007

Type	Read
Score	93
Start on Template	91
Length on Template	14
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

C2119_006

Type	Read
Score	171
Start on Template	57
Length on Template	26
Start on Read	0
Length of Read	27
Unique	Yes
Positional Score
Alignment graphic

C2433_006

Type	Read
Score	118
Start on Template	83
Length on Template	23
Start on Read	0
Length of Read	24
Unique	Yes
Positional Score
Alignment graphic

C1204_011

Type	Read
Score	85
Start on Template	61
Length on Template	15
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

Combined_3870

Type	Read
Score	110
Start on Template	58
Length on Template	19
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1295_013

Type	Read
Score	68
Start on Template	167
Length on Template	11
Start on Read	0
Length of Read	10
Unique	Yes
Positional Score
Alignment graphic

C1396_007

Type	Read
Score	115
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1444_009

Type	Read
Score	110
Start on Template	61
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C1744_006

Type	Read
Score	112
Start on Template	57
Length on Template	24
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

C2074_008

Type	Read
Score	181
Start on Template	58
Length on Template	25
Start on Read	0
Length of Read	28
Unique	Yes
Positional Score
Alignment graphic

Combined_3104

Type	Read
Score	110
Start on Template	216
Length on Template	15
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

C242_022

Type	Read
Score	142
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C524_010

Type	Read
Score	119
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	22
Unique	Yes
Positional Score
Alignment graphic

C548_013

Type	Read
Score	98
Start on Template	87
Length on Template	20
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

C177_021

Type	Read
Score	142
Start on Template	115
Length on Template	18
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C190_024

Type	Read
Score	97
Start on Template	115
Length on Template	18
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C238_023

Type	Read
Score	104
Start on Template	61
Length on Template	16
Start on Read	0
Length of Read	24
Unique	Yes
Positional Score
Alignment graphic

C241_014

Type	Read
Score	102
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

C250_018

Type	Read
Score	124
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_3109

Type	Read
Score	100
Start on Template	117
Length on Template	16
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C538_009

Type	Read
Score	126
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

C166_017

Type	Read
Score	116
Start on Template	115
Length on Template	18
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

Combined_3663

Type	Read
Score	68
Start on Template	97
Length on Template	10
Start on Read	0
Length of Read	10
Unique	Yes
Positional Score
Alignment graphic

C261_017

Type	Read
Score	104
Start on Template	58
Length on Template	19
Start on Read	0
Length of Read	24
Unique	Yes
Positional Score
Alignment graphic

C268_017

Type	Read
Score	112
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

C327_014

Type	Read
Score	78
Start on Template	85
Length on Template	12
Start on Read	0
Length of Read	12
Unique	Yes
Positional Score
Alignment graphic

C866_008

Type	Read
Score	101
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C225_016

Type	Read
Score	124
Start on Template	58
Length on Template	19
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C247_018

Type	Read
Score	88
Start on Template	117
Length on Template	16
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

Combined_3130

Type	Read
Score	84
Start on Template	85
Length on Template	12
Start on Read	0
Length of Read	12
Unique	Yes
Positional Score
Alignment graphic

Combined_3654

Type	Read
Score	133
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C224_014

Type	Read
Score	110
Start on Template	115
Length on Template	18
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C483_017

Type	Read
Score	98
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C598_010

Type	Read
Score	130
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_3661

Type	Read
Score	133
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C274_017

Type	Read
Score	97
Start on Template	115
Length on Template	18
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C879_015

Type	Read
Score	123
Start on Template	59
Length on Template	18
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

C243_016

Type	Read
Score	106
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C247_019

Type	Read
Score	132
Start on Template	58
Length on Template	19
Start on Read	0
Length of Read	23
Unique	Yes
Positional Score
Alignment graphic

Combined_3136

Type	Read
Score	106
Start on Template	115
Length on Template	18
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C288_009

Type	Read
Score	142
Start on Template	58
Length on Template	19
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C383_013

Type	Read
Score	97
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C285_007

Type	Read
Score	106
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C299_014

Type	Read
Score	88
Start on Template	117
Length on Template	17
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C483_018

Type	Read
Score	98
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C268_019

Type	Read
Score	106
Start on Template	59
Length on Template	18
Start on Read	0
Length of Read	23
Unique	Yes
Positional Score
Alignment graphic

C272_016

Type	Read
Score	111
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

Combined_3647

Type	Read
Score	84
Start on Template	85
Length on Template	12
Start on Read	0
Length of Read	12
Unique	Yes
Positional Score
Alignment graphic

C520_013

Type	Read
Score	134
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_3198

Type	Read
Score	77
Start on Template	220
Length on Template	11
Start on Read	0
Length of Read	13
Unique	Yes
Positional Score
Alignment graphic

C1440_010

Type	Read
Score	97
Start on Template	57
Length on Template	15
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

C1861_013

Type	Read
Score	66
Start on Template	133
Length on Template	10
Start on Read	0
Length of Read	10
Unique	Yes
Positional Score
Alignment graphic

Combined_3520

Type	Read
Score	70
Start on Template	22
Length on Template	11
Start on Read	0
Length of Read	11
Unique	Yes
Positional Score
Alignment graphic

C3360

Type	Read
Score	66
Start on Template	32
Length on Template	10
Start on Read	0
Length of Read	10
Unique	Yes
Positional Score
Alignment graphic

Combined_3537

Type	Read
Score	75
Start on Template	133
Length on Template	10
Start on Read	0
Length of Read	10
Unique	Yes
Positional Score
Alignment graphic

C1271_016

Type	Read
Score	93
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C1292_010

Type	Read
Score	87
Start on Template	57
Length on Template	15
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C661_016

Type	Read
Score	64
Start on Template	89
Length on Template	8
Start on Read	0
Length of Read	8
Unique	Yes
Positional Score
Alignment graphic

C1537_014

Type	Read
Score	61
Start on Template	33
Length on Template	9
Start on Read	0
Length of Read	9
Unique	Yes
Positional Score
Alignment graphic

C1579_009

Type	Read
Score	79
Start on Template	60
Length on Template	12
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

C1593_008

Type	Read
Score	91
Start on Template	60
Length on Template	14
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C1721_012

Type	Read
Score	81
Start on Template	60
Length on Template	12
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

C1798_008

Type	Read
Score	79
Start on Template	60
Length on Template	12
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

C963_014

Type	Read
Score	71
Start on Template	94
Length on Template	10
Start on Read	0
Length of Read	10
Unique	Yes
Positional Score
Alignment graphic

C1236_011

Type	Read
Score	71
Start on Template	33
Length on Template	9
Start on Read	0
Length of Read	10
Unique	Yes
Positional Score
Alignment graphic

C1371_010

Type	Read
Score	67
Start on Template	133
Length on Template	10
Start on Read	0
Length of Read	11
Unique	No
Positional Score
Alignment graphic

C1408_008

Type	Read
Score	88
Start on Template	57
Length on Template	15
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

C1817_011

Type	Read
Score	75
Start on Template	191
Length on Template	10
Start on Read	0
Length of Read	10
Unique	Yes
Positional Score
Alignment graphic

C1498_011

Type	Read
Score	79
Start on Template	60
Length on Template	12
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

C20_013

Type	Read
Score	76
Start on Template	97
Length on Template	10
Start on Read	0
Length of Read	13
Unique	Yes
Positional Score
Alignment graphic

C62_012

Type	Read
Score	128
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C71_024

Type	Read
Score	145
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	24
Unique	Yes
Positional Score
Alignment graphic

C73_029

Type	Read
Score	105
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	22
Unique	Yes
Positional Score
Alignment graphic

C74_022

Type	Read
Score	142
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	22
Unique	Yes
Positional Score
Alignment graphic

C76_020

Type	Read
Score	135
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	25
Unique	Yes
Positional Score
Alignment graphic

C77_021

Type	Read
Score	129
Start on Template	58
Length on Template	19
Start on Read	0
Length of Read	26
Unique	Yes
Positional Score
Alignment graphic

C78_020

Type	Read
Score	142
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	22
Unique	Yes
Positional Score
Alignment graphic

C89_023

Type	Read
Score	108
Start on Template	115
Length on Template	18
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

C92_026

Type	Read
Score	96
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C142_021

Type	Read
Score	94
Start on Template	133
Length on Template	14
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

C276_025

Type	Read
Score	100
Start on Template	117
Length on Template	16
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C68_025

Type	Read
Score	107
Start on Template	59
Length on Template	18
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C77_022

Type	Read
Score	116
Start on Template	58
Length on Template	19
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C78_022

Type	Read
Score	123
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	23
Unique	Yes
Positional Score
Alignment graphic

Combined_3656

Type	Read
Score	67
Start on Template	106
Length on Template	9
Start on Read	0
Length of Read	10
Unique	Yes
Positional Score
Alignment graphic

C70_015

Type	Read
Score	107
Start on Template	59
Length on Template	18
Start on Read	0
Length of Read	23
Unique	Yes
Positional Score
Alignment graphic

C79_026

Type	Read
Score	96
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C211_016

Type	Read
Score	133
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C531_018

Type	Read
Score	130
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C144_025

Type	Read
Score	110
Start on Template	58
Length on Template	19
Start on Read	0
Length of Read	25
Unique	Yes
Positional Score
Alignment graphic

C172_023

Type	Read
Score	133
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C165_020

Type	Read
Score	98
Start on Template	78
Length on Template	19
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C217_018

Type	Read
Score	104
Start on Template	58
Length on Template	19
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C222_025

Type	Read
Score	101
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C623_013

Type	Read
Score	165
Start on Template	78
Length on Template	29
Start on Read	0
Length of Read	30
Unique	Yes
Positional Score
Alignment graphic

C790_016

Type	Read
Score	127
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

C801_017

Type	Read
Score	141
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

C183_021

Type	Read
Score	133
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C189_029

Type	Read
Score	136
Start on Template	58
Length on Template	19
Start on Read	0
Length of Read	24
Unique	Yes
Positional Score
Alignment graphic

C117_025

Type	Read
Score	138
Start on Template	58
Length on Template	19
Start on Read	0
Length of Read	22
Unique	Yes
Positional Score
Alignment graphic

C126_027

Type	Read
Score	141
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	23
Unique	Yes
Positional Score
Alignment graphic

C300_016

Type	Read
Score	125
Start on Template	58
Length on Template	19
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C310_022

Type	Read
Score	116
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C925_012

Type	Read
Score	138
Start on Template	55
Length on Template	22
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

C243_022

Type	Read
Score	97
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C250_021

Type	Read
Score	145
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	24
Unique	Yes
Positional Score
Alignment graphic

C254_024

Type	Read
Score	125
Start on Template	58
Length on Template	19
Start on Read	0
Length of Read	23
Unique	Yes
Positional Score
Alignment graphic

C259_018

Type	Read
Score	68
Start on Template	87
Length on Template	10
Start on Read	0
Length of Read	10
Unique	No
Positional Score
Alignment graphic

Combined_3935

Type	Read
Score	102
Start on Template	115
Length on Template	19
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

C780_017

Type	Read
Score	106
Start on Template	61
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

Combined_3903

Type	Read
Score	125
Start on Template	61
Length on Template	16
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C815_024

Type	Read
Score	106
Start on Template	59
Length on Template	18
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C865_018

Type	Read
Score	128
Start on Template	53
Length on Template	24
Start on Read	0
Length of Read	24
Unique	Yes
Positional Score
Alignment graphic

C897_014

Type	Read
Score	117
Start on Template	57
Length on Template	18
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

C997_020

Type	Read
Score	82
Start on Template	133
Length on Template	26
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C1099_007

Type	Read
Score	120
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1134_008

Type	Read
Score	103
Start on Template	59
Length on Template	18
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1157_015

Type	Read
Score	100
Start on Template	58
Length on Template	19
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1165_014

Type	Read
Score	70
Start on Template	87
Length on Template	11
Start on Read	0
Length of Read	11
Unique	Yes
Positional Score
Alignment graphic

C213_022

Type	Read
Score	72
Start on Template	39
Length on Template	9
Start on Read	0
Length of Read	9
Unique	Yes
Positional Score
Alignment graphic

C616_015

Type	Read
Score	114
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C696_014

Type	Read
Score	103
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C704_017

Type	Read
Score	110
Start on Template	58
Length on Template	19
Start on Read	0
Length of Read	23
Unique	Yes
Positional Score
Alignment graphic

Combined_3814

Type	Read
Score	151
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_3972

Type	Read
Score	93
Start on Template	61
Length on Template	15
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

C1198_015

Type	Read
Score	97
Start on Template	87
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_3816

Type	Read
Score	124
Start on Template	61
Length on Template	16
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_3813

Type	Read
Score	133
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_3853

Type	Read
Score	133
Start on Template	59
Length on Template	18
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C812_018

Type	Read
Score	97
Start on Template	60
Length on Template	17
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C722_023

Type	Read
Score	110
Start on Template	58
Length on Template	19
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C871_017

Type	Read
Score	121
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C885_016

Type	Read
Score	120
Start on Template	61
Length on Template	16
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C1039_012

Type	Read
Score	123
Start on Template	58
Length on Template	19
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1203_020

Type	Read
Score	122
Start on Template	78
Length on Template	19
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

C178_024

Type	Read
Score	76
Start on Template	96
Length on Template	11
Start on Read	0
Length of Read	12
Unique	Yes
Positional Score
Alignment graphic

C206_021

Type	Read
Score	68
Start on Template	77
Length on Template	10
Start on Read	0
Length of Read	10
Unique	Yes
Positional Score
Alignment graphic

C433_020

Type	Read
Score	151
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C611_020

Type	Read
Score	137
Start on Template	58
Length on Template	19
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C658_017

Type	Read
Score	131
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C709_012

Type	Read
Score	106
Start on Template	60
Length on Template	17
Start on Read	0
Length of Read	22
Unique	Yes
Positional Score
Alignment graphic

C723_014

Type	Read
Score	128
Start on Template	59
Length on Template	18
Start on Read	0
Length of Read	23
Unique	Yes
Positional Score
Alignment graphic

C829_018

Type	Read
Score	127
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C975_018

Type	Read
Score	107
Start on Template	91
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C1174_013

Type	Read
Score	130
Start on Template	59
Length on Template	18
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1184_017

Type	Read
Score	107
Start on Template	78
Length on Template	19
Start on Read	0
Length of Read	24
Unique	Yes
Positional Score
Alignment graphic

Combined_3918

Type	Read
Score	102
Start on Template	60
Length on Template	17
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C597_014

Type	Read
Score	119
Start on Template	60
Length on Template	17
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C673_019

Type	Read
Score	115
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C678_012

Type	Read
Score	120
Start on Template	58
Length on Template	19
Start on Read	0
Length of Read	22
Unique	Yes
Positional Score
Alignment graphic

C707_016

Type	Read
Score	101
Start on Template	60
Length on Template	17
Start on Read	0
Length of Read	22
Unique	Yes
Positional Score
Alignment graphic

C913_014

Type	Read
Score	117
Start on Template	26
Length on Template	28
Start on Read	0
Length of Read	27
Unique	Yes
Positional Score
Alignment graphic

C957_018

Type	Read
Score	110
Start on Template	91
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C1015_020

Type	Read
Score	83
Start on Template	133
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C1096_018

Type	Read
Score	109
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1177_009

Type	Read
Score	139
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	24
Unique	Yes
Positional Score
Alignment graphic

C1199_007

Type	Read
Score	99
Start on Template	78
Length on Template	19
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C1399_015

Type	Read
Score	109
Start on Template	60
Length on Template	25
Start on Read	0
Length of Read	27
Unique	Yes
Positional Score
Alignment graphic

C1417_012

Type	Read
Score	126
Start on Template	58
Length on Template	19
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C437_017

Type	Read
Score	102
Start on Template	57
Length on Template	14
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

C830_019

Type	Read
Score	96
Start on Template	59
Length on Template	18
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C852_019

Type	Read
Score	108
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C866_012

Type	Read
Score	135
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	24
Unique	Yes
Positional Score
Alignment graphic

C1012_016

Type	Read
Score	158
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

C1207_015

Type	Read
Score	84
Start on Template	134
Length on Template	21
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C1291_006

Type	Read
Score	100
Start on Template	83
Length on Template	14
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

C1454_007

Type	Read
Score	115
Start on Template	61
Length on Template	16
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1485_011

Type	Read
Score	109
Start on Template	133
Length on Template	22
Start on Read	0
Length of Read	24
Unique	Yes
Positional Score
Alignment graphic

C1549_017

Type	Read
Score	121
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C398_019

Type	Read
Score	100
Start on Template	57
Length on Template	14
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

C706_018

Type	Read
Score	144
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

C784_011

Type	Read
Score	106
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C794_013

Type	Read
Score	146
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	23
Unique	Yes
Positional Score
Alignment graphic

C920_020

Type	Read
Score	116
Start on Template	61
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

Combined_3936

Type	Read
Score	142
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1310_007

Type	Read
Score	118
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	23
Unique	Yes
Positional Score
Alignment graphic

Combined_3950

Type	Read
Score	112
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C540_020

Type	Read
Score	101
Start on Template	45
Length on Template	32
Start on Read	0
Length of Read	23
Unique	Yes
Positional Score
Alignment graphic

C542_016

Type	Read
Score	111
Start on Template	59
Length on Template	18
Start on Read	0
Length of Read	22
Unique	Yes
Positional Score
Alignment graphic

C545_018

Type	Read
Score	116
Start on Template	58
Length on Template	19
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C653_011

Type	Read
Score	81
Start on Template	61
Length on Template	15
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

C913_016

Type	Read
Score	100
Start on Template	83
Length on Template	14
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

C961_014

Type	Read
Score	99
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C991_014

Type	Read
Score	106
Start on Template	87
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1097_014

Type	Read
Score	138
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C941_017

Type	Read
Score	95
Start on Template	58
Length on Template	19
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1115_012

Type	Read
Score	141
Start on Template	58
Length on Template	19
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1183_014

Type	Read
Score	85
Start on Template	59
Length on Template	17
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

C918_020

Type	Read
Score	109
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	23
Unique	Yes
Positional Score
Alignment graphic

C923_019

Type	Read
Score	68
Start on Template	87
Length on Template	10
Start on Read	0
Length of Read	10
Unique	Yes
Positional Score
Alignment graphic

C955_014

Type	Read
Score	84
Start on Template	117
Length on Template	16
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C869_021

Type	Read
Score	111
Start on Template	58
Length on Template	19
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C874_014

Type	Read
Score	124
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	22
Unique	Yes
Positional Score
Alignment graphic

C881_016

Type	Read
Score	142
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	22
Unique	Yes
Positional Score
Alignment graphic

C890_019

Type	Read
Score	106
Start on Template	61
Length on Template	16
Start on Read	0
Length of Read	22
Unique	Yes
Positional Score
Alignment graphic

C933_019

Type	Read
Score	96
Start on Template	57
Length on Template	15
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

C1070_013

Type	Read
Score	115
Start on Template	57
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1259_011

Type	Read
Score	84
Start on Template	133
Length on Template	15
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

C1361_007

Type	Read
Score	130
Start on Template	77
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1404_012

Type	Read
Score	115
Start on Template	59
Length on Template	18
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1425_014

Type	Read
Score	122
Start on Template	87
Length on Template	18
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

>TRYP template
FPTDDDDKIVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKFVIEVRLGEHNIDVLEGNEQFINAAKIITHPNFDGNTLDNDIMLIKLSSPATLNSRVATVSLPRSCAAAGTECLISGWGNTKSSGSSYPSLLQCLKAPVLSDSSCKSSYPGQITNGMICVGFLEGGKDSCQGDSGGPVVCDGQLQGIVSWGYGPGMKNKPGVYTKVCNYVNWVQQTIAAN
>C1601_006 score:127 alignment:3I19M2D17M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~REHNLD.VLEPTTHNLDVLEPSV...H.N.LDV...L......E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C540_020 score:101 alignment:10M9D13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AAHNQDLVLT............E...L......E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C753_005 score:131 alignment:31M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~APANPLRVCPANYPAVLA..ANMLCVGFLEGGK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1726_010 score:85 alignment:12M13D5M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SSGSS.YPSLLQG................SHSGQ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C623_013 score:165 alignment:1I11M1S[2,2]16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KLT.H..P...T.D..S.S.L...K....L...N.....DDLMLLK.L.S.SP.A..TLNSR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2120_002 score:115 alignment:17M3D2M5D2M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~G.N...T....L...D.....NDLMLLR.L.S.SP.F.....ER......LP~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C913_014 score:117 alignment:1I5M2D21M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~DDDDS.H..GGSLLNSQW.VVSAAHMGSHSS~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1379 score:106 alignment:13M2D9M1I4M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...L......E.....Q...HN.......L.DVLQELV.HH.P...N.F..N~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1098_006 score:87 alignment:11M12D5M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SSGSS.YPSLLQ...............SSSYE~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3033 score:127 alignment:14M1D13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...L......E.....V...MH....N..L.DVLELYT.H..P...N.F..N~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C835 score:116 alignment:28M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...L......E.....A...GH....NL.D.VLQELVH.H..P...N.F..N~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2451_002 score:115 alignment:5M5D17M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QT.F.NS......H..P...N.F..G.D.N...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1285_004 score:104 alignment:4M1S[2,2]6D11M1S[2,2]2M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KYLLLN.........LDV...L......E.....G...NE....QM.L.GQAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2328_003 score:116 alignment:1I27M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VGE.H.N.LDV...L......E.....V...NH....NL.D.VLEHAVT.H..P...N.F..N~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2119_006 score:171 alignment:13M1S[1,2]2M1S[2,2]8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGH.Q.D.LDV...L......E.....G...NE....GAF.L.ANAKLLT.H..P...N~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C319_004 score:98 alignment:13M6D7M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SC.AAAGTEC.LLS.G........SVSC.AAA~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2335_003 score:181 alignment:13M1S[1,2]2M1S[1,2]9M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGH.Q.D.LDV...L......E.....G...NE....GAF.L.GGAAKLLT.H..P...N~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2112_004 score:130 alignment:5M1I4M1I5M1D1M1S[1,2]9M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LAG.H.DALDV...LL.....E.....G...NE....M..L.GGAAKLLT.H..P...N~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1727_005 score:171 alignment:1S[2,2]11M1S[1,2]2M1S[1,2]9M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VAH.Q.D.LDV...L......E.....G...NE....GAF.L.GGAAKLLT.H..P...N~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1413_007 score:161 alignment:1S[2,2]8M1S[2,2]4M1S[1,2]9M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VAH.Q.D.LDV...L......E.....N...GE....QF.L.GGAAKLLT.H..P...N~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C997_020 score:82 alignment:11M8D3M2D2M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TSGSS.YPSLLQ...........DYS..SS~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1399_015 score:109 alignment:3I11M1D13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SLDH.N.LDV...L......E.....V...NH....N..L.DVLELYT.H..P...N.F..N~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C613 score:102 alignment:6M4D7M3I8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L.LAAHL..........D.N..D.G.N...T....LTTMD.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C437_002 score:117 alignment:12M1D12M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L.LAAHLDN.D..G...N.T....G.N...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2087_007 score:172 alignment:1I12M1S[1,2]2M1S[1,2]9M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GVE.H.N.LEV...L......E.....G...NE....GAM.L.GGAAKLLT.H..P...N~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1206 score:157 alignment:1I12M1S[1,2]2M1S[2,2]8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VGH.Q.D.LEV...L......E.....G...NE....GAF.L.ANAKLLT.H..P...N~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2074_008 score:181 alignment:1I12M1S[1,2]2M1S[1,2]9M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GVE.H.N.LEV...L......E.....G...NE....GAF.L.GGAAKLLT.H..P...N~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C266_002 score:97 alignment:1I4M1D10M5D4M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ASC.AA.GTEC.LLS.GW.G......GSV.K~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C865_018 score:128 alignment:1S[2,2]22M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QLVRAPF.H.N.LDV...L......E.....G...SH....FF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C678_004 score:144 alignment:14M1I10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SSGSS.YPSLLSN..RTVAPVLSDSSCK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C679 score:118 alignment:15M5D4M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SC.AAAGTEC.LLS.GW.G......GSV.K~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C399_010 score:118 alignment:15M1D8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~S.HFCGGSLLNSQW.VW.AAHGHDAA~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C820_004 score:139 alignment:12M1I12M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TSGSS.YPSLGFRP.LV.APVLSDSSCK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C509_005 score:127 alignment:1I3M1S[2,1]19M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AHFCNSLLNSQW.VVSAAHNARFPH~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C246_009 score:100 alignment:15M5D4M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SC.AAAGTEC.LLS.VM.G......GSV.K~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2230_002 score:156 alignment:24M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SSGSS.YPSLSAW..LR.APVLSDSSCK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1681 score:135 alignment:14M1I10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SSGSS.YPSLLLA..RTDAPVLSNSSCK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2948 score:109 alignment:10M2D12M unique:True
~~~~~~~~~LVSGYQPYQV...PYQVSLNSGS.HF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1379_008 score:166 alignment:18M1S[2,2]4M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~F..D.G.N...T....L...D.....NDLMLLR.L.S.SP.T..ALNSR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1807_005 score:144 alignment:14M1I10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SSGSS.YPSLLLA..RTDAPVLSDSSCK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1744_006 score:112 alignment:2M1S[2,2]6M1S[2,2]5M3D4M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGH.E.N.LDV...L......E.....N...GE....QF.L.N...LGE.H~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C957_002 score:93 alignment:17M2D1S[2,2]2M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~G.N...T....L...D.....DDLMLLR.L.P.SM.P....SNR.K~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2034_004 score:107 alignment:23M unique:True
~~~~~~~~~~VLMAGPSYD.SVPYQVSLNSGS.HF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1530_007 score:91 alignment:6M4D13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ARYLLD.............D.T.C...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C741_006 score:93 alignment:13M2D4M1S[2,2]2M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~G.N...T....L...D.....DDLMLLR.L....P.M..SPSNR.K~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C409_005 score:128 alignment:6M1D16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GG.HFSC.SLQNSQW.VVSAAHCYK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C151_007 score:101 alignment:12M4D7M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SC.AAAGTEC.LLS.......TKSCAAA~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1480 score:119 alignment:15M4D4M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SC.AAAGTEC.LLS.GW.G.....SGVK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2397 score:139 alignment:2I10M1S[1,2]12M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGKLLT.H..P...N.F..D.G.GG...T....L...D.....NDLSKGK.L.L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2433_006 score:118 alignment:14M1I9M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~F..N.G.N...T....L...D.....NDLMLLGVL.S.SG.L..HLRY~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C200_009 score:114 alignment:13M1S[1,2]1M4D4M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SC.AAAGTEC.LLS.GAM.G.....SGVK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C360_006 score:102 alignment:1I23M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SCAAASC.AAAGTEC.LLS.GG.EG.SKR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C695_005 score:114 alignment:6M2D15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~EGNPGT.....LDV...L......E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C555 score:103 alignment:2M1D14M1D5M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~N.G.....T....L...D.....NDLMLLR.L.S.SP....TQREK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2433 score:137 alignment:1I4M1D17M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GLNE.H...LDV...L......E.....G...NE....QF.L.NAARLL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1485_011 score:109 alignment:12M2I10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SSGSS.YPSLLQSDQLS.RPSLLSSS~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1519_007 score:105 alignment:3I22M unique:True
~~~~~~~~AGLMVSNQVQD.SLPYQVSLNSGS.HF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1358_004 score:95 alignment:22M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VGLML.F.Q.ENG...E......E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2313 score:149 alignment:2I10M1S[1,2]11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGKLLT.H..P...N.F..D.G.GG...T....L...D.....NDLMLRL.L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1408 score:113 alignment:22M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AGLTH.G..L...G.D..N.G.N...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3662 score:138 alignment:4M1D17M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VPLL..H.N.LDV...L......E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2383 score:157 alignment:1S[2,2]20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AVE.H.N.LDV...L......E.....G...NE....QF.L.NAARLL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C925_012 score:138 alignment:2M1D19M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VR.GF.L.N.LDV...L......E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C670_004 score:106 alignment:5M3D14M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VMDRE......EV...L......E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1610_008 score:107 alignment:1I22M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~RVFLFQ.K.D.LDV...L......A.....E...NQ....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1443_009 score:143 alignment:1I22M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AT.HFCGGSLLNSQW.VVSAAHFMR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C986_003 score:106 alignment:8M1D13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AGLAA.H..L...D....N.M.N...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1049_003 score:138 alignment:1M1S[2,2]18M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~RGLF.V.N.LDV...L......E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2593_002 score:143 alignment:9M1S[1,2]11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLS.H..P...N.F..D.G.GG...T....L...D.....NDLMLLR.L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1214_003 score:107 alignment:7M1D13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KLAA.H..L...D....N.M.N...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1677_002 score:127 alignment:21M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KLGT.H..L...G.D..N.G.N...T....L...D.....DDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1491_004 score:109 alignment:21M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KLTH.G..L...G.D..N.G.N...T....L...D.....DDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1252_002 score:140 alignment:1M1S[2,2]18M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~RAVF.L.N.LDV...L......E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1207_015 score:84 alignment:1I12M5D4M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ASGSS.YPSLLQG..Y......SSSS~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1662_009 score:114 alignment:21M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KLTH.G..L...G.D..N.G.N...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2590 score:120 alignment:9M1S[1,2]3I11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.H..G...S.W..D.G.GGGTMT....L...D.....NDLMLLK.L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1378 score:105 alignment:21M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~G.N...T....L...D.....NDLMLLR.L.S.SG.L..HRLY~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2063 score:110 alignment:2I16M2D3M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GAGE.L.H.LDV...L......E.....G...NE....QF.L.N..KLF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C270 score:116 alignment:1S[1,2]6M1D3M2I10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGAGE.H.D.L.V...L......ETE...G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1290_002 score:119 alignment:2I3M2D16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TFRLL....N.LDV...L......E.....G...NE....QM.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1234_006 score:109 alignment:21M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KPRP.L..P...N.S..D.L.N...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1151_004 score:111 alignment:1I4M2D15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SRDLE.....LDV...L......E.....G...NQ....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2608_002 score:118 alignment:6M1I5M2I2M1S[1,2]7M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.H..P...SGF..D.G.N...TMT..L...N.....GGDLMLLK.L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1741_004 score:117 alignment:7M2I1S[1,2]13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.H..G...S.GLD..GG.G.G...T....L...D.....NDLMLLK.L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1626_002 score:140 alignment:9M1S[1,2]1I11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.H..P...G.F..D.G.GGG..T....L...D.....NDLMLLK.L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1508_003 score:103 alignment:3M2D16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VDL...H.N.LDV...L......E.....G...NE....QF.L.RKN~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1007 score:100 alignment:15M2D1S[2,2]2M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SC.AAAGTES.ELS.GW.G...SKVG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2185_002 score:102 alignment:10M1I11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~CGGSLLNSQGQVVSAAHSGGCD~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C837_002 score:98 alignment:7M1D13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KLAA.H..L...D....N.D.M...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1400 score:107 alignment:7M1D13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KLGT.H..L...D....N.D.L...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1667_007 score:96 alignment:21M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~G.N...T....L...D.....NDLMLRL.L.S.SG.L..HRLY~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1364_009 score:128 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.D.LDV...L......V.....E...NS....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C746_003 score:106 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~T....L...D.....NDLMLLR.L.S.SP.S..SQLAR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C263 score:133 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...L......E.....V...LS....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1520_008 score:97 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGL.H..T...L.D..N.D.Q...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2941 score:97 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...N......N.....H...EV....DM.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1618_008 score:117 alignment:13M1S[1,2]6M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.H..P...A.T..L.D.N...D....L...D.....GGDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2657 score:142 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...L......E.....G...NE....QF.L.NAKV~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1262_002 score:126 alignment:5M1S[1,2]14M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LTY.H..P...GG.F..D.G.N...T....L...N.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C827_013 score:133 alignment:2M1S[3,3]15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGH.N.E.LDV...L......E.....G...NE....QY.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C913_007 score:120 alignment:2M1S[3,3]1S[2,2]3M1S[2,2]8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGH.N.E.DLV...L......E.....N...GE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C923_009 score:101 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...L......N.....N...HV....DM.L.DAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3127 score:133 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...L......E.....S...MS....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1426_003 score:119 alignment:10M2I10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGH.Q.D.LEV...L......ETE...G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2939 score:124 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...L......E.....T...PD....HF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1010_007 score:102 alignment:1S[2,2]16M1S[2,2] unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VAE.H.N.LDV...L......E.....N...LV....DF.L.NAKA~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C686_010 score:141 alignment:12M3I8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.H..P...N.F..D.G.N...T....LLTMD.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3851 score:120 alignment:5M1S[2,2]3M1S[2,2]8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.Q.DLV...L......E.....N...GN....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1447_004 score:112 alignment:18M1S[2,2] unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...L......E.....N...LV....DF.L.NAKA~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1551_009 score:126 alignment:9M1S[1,2]10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.H..T...T.N..D.G.GG...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C991_014 score:106 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~T....L...D.....NDLMLLR.L.S.SA.T..RLPSN~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1975_008 score:95 alignment:8M1D11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~G.Q...T....L...D.....SSD.LLR.L.S.SP.A..TLN~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3009 score:124 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...L......N.....G...EE....QF.L.NAKV~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_063 score:107 alignment:1I6M1D13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGLT.H..L...D....N.M.N...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1190_015 score:106 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...N......D.....H...QV....DF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1752_006 score:104 alignment:9M1D10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.H..P...F.L..N.H.....T....F...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1890_003 score:132 alignment:12M3I8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.H..P...T.F..N.G.N...T....LNTLD.....DDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1908_005 score:130 alignment:9M1S[1,2]3M3I7M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.H..P...T.F..D.G.GG...T....L...DTLD..NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1939_004 score:101 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.A..H...P.E..T.M.D...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1621_006 score:122 alignment:9M1D10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.H..P...N.F..N.H.....T....F...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1639_008 score:121 alignment:5M1I15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LAE.N.NGLDV...L......E.....G...NQ....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1751_006 score:121 alignment:5M3I2M1S[1,2]12M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.H..PTGVD.G..GG.T.N...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1431 score:158 alignment:9M1S[1,2]10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.H..P...N.F..N.G.GG...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1771_011 score:121 alignment:11M1S[1,2]8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LPP.N.D.LEV...L......E.....G...GGE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1270 score:124 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...L......E.....T...LV....DF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2289_004 score:135 alignment:9M1S[1,2]10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.H..P...D.N..E.G.GG...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1339_011 score:124 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...L......E.....E...LV....DF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3950 score:112 alignment:2M1S[2,2]16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGH.E.N.LDV...N......E.....H...NV....DF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1310_007 score:118 alignment:11M3I9M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.H..V...D.R..D.G.N...TANT.L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1271_006 score:123 alignment:1I20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LPLL.H.N.LDV...L......E.....G...NE....QM.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1274_004 score:96 alignment:1I20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QLLL.H.N.LDV...L......E.....C...GL....NM.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1848_003 score:136 alignment:5M1S[2,2]2M1S[1,2]10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.H..P...F.N..D.G.GG...T....L...D.....DDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1844_006 score:92 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LAH.L..T...L.D..N.D.D...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1271 score:135 alignment:9M1S[1,2]10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLN.H..P...T.F..D.G.GG...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1870_007 score:140 alignment:9M1S[1,2]10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.H..P...N.F..N.G.GG...T....L...D.....NDPVLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C811_004 score:95 alignment:4M2I5M1D10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.LSGP...N.F..Q.T.....T....L...D.....DDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C643_006 score:96 alignment:5M2D5M1I8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.H..P........F.H.D...T....LF..D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1373_011 score:114 alignment:5M1S[2,2]13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGD.H.Q.DLV...L......E.....G...NE....QF.L.NAKV~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2729 score:155 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...L......E.....G...DE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1624_002 score:123 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.D.LDV...L......E.....V...DV....DF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_017 score:160 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...L......E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1196_010 score:115 alignment:2M1S[3,3]15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGH.N.E.LDV...L......E.....G...NE....QF.L.NGKV~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C961_014 score:99 alignment:12M1D7M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LPY.E.N.LDV...L......E.....M...D.....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_826 score:156 alignment:7M1S[1,2]1M1S[1,2]10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.H..P...N.F..GG.G.GG...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1794 score:143 alignment:1S[2,2]18M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GLE.H.D.LDV...L......E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C829_006 score:104 alignment:16M1S[1,2]3M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...L......E.....G...LV....DL.N.GGMAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2722_002 score:111 alignment:10M1S[2,2]8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LPP.N.D.LEV...L......E.....N...GE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3831 score:96 alignment:5M1S[2,2]13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LDG.H.Q.DLV...L......E.....G...NE....QF.L.NGKV~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1057_011 score:115 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...L......N.....N...HV....DF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1058_009 score:124 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...N......E.....H...NV....NF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1092_007 score:129 alignment:5M1S[2,2]3M1S[2,2]8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.DLV...L......E.....N...GQ....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2794 score:142 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGY.E.N.LDV...L......E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1493 score:117 alignment:1I1S[2,2]8M1S[2,2]8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KGLY.L.N.LDV...L......E.....N...GE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2398_003 score:130 alignment:2M1S[3,3]5M1S[2,2]8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGH.N.E.LDV...L......E.....N...GE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1460_007 score:98 alignment:10M1I10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.H..H...G.Y..D.G.GA..T....V...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1936_003 score:128 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.H..M...D.G..N.L.N...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1518_003 score:133 alignment:2M1S[3,3]15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGH.N.E.LDV...L......E.....G...NQ....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1530_003 score:132 alignment:1I20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LPLL.H.N.LDV...L......E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C725_004 score:116 alignment:1I4M1D15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ALGE.H...LDV...L......E.....G...DE....QF.L.NGVK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_994 score:97 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...L......D.....D...LV....DF.L.NAKV~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1356_005 score:117 alignment:1I4M1D5M2I10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ALEE.H...LDV...L......ELE...G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1264 score:111 alignment:2M1S[3,3]1S[2,2]3M1S[2,2]8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGH.N.E.DLV...L......E.....N...GQ....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_991 score:136 alignment:1S[2,2]7M3I11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AVE.H.N.LDV...LTEM...E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3651 score:128 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LEV...L......N.....G...NE....QF.L.NGVK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1361 score:121 alignment:1I17M1D2M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GVE.H.N.LDV...L......E.....G...NE....QF.L.NG.KL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1634_005 score:97 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGL.H..T...L.D..N.D.N...N....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C918_020 score:109 alignment:9M3I11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LAH.N.D.LEV...LNGE...E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2027_003 score:159 alignment:1I20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PLGE.H.N.LDV...L......E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2143_002 score:144 alignment:5M1S[1,2]14M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.H..P...GG.E..D.G.N...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2378_003 score:123 alignment:5M1S[2,2]13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LNG.H.E.DLV...L......E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1067 score:124 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...L......E.....T...LV....NF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1123 score:137 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...L......E.....G...DE....QF.L.NGVK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1078_005 score:98 alignment:8M1I12M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLV.H..G...L.G..DDG.N...T....M...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_047 score:142 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...L......E.....G...NE....QF.L.NGVK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1061 score:143 alignment:18M1S[2,2] unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LEV...L......E.....G...NE....QF.L.NAKA~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1064 score:97 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LDH.L.N.LDV...V......E.....G...NE....QF.L.NGKV~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1554_006 score:115 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...L......T.....E...LV....NF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1376_005 score:119 alignment:4M1D5M1S[2,2]8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LQE.H...LDV...L......E.....N...GE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C721_006 score:106 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLV.G..H...L.D..N.M.N...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C710_008 score:99 alignment:13M1D6M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.H..P...F.H..D.T.N...F....L...D......DLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1361_007 score:130 alignment:8M1S[2,2]10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.H..P...F.L..N.N.G...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2644_002 score:137 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGH.Q.D.LDV...L......E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2477 score:125 alignment:1I7M1I1M1S[1,2]3M1S[1,2]7M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ALT.H..P...S.T..NDG.GG...T....L...D.....GGDLMLLK.L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1070_013 score:115 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...L......T.....E...LV....DF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C546_008 score:93 alignment:2M1S[2,2]16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLH.T..L...A.D..D.D.L...T....L...D.....DDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C881_016 score:142 alignment:10M2I10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LEV...L......EEE...G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_046 score:101 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...L......E.....T...LV....DL.M.DAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C911_004 score:137 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.H..P...M.L..D.G.N...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C874_014 score:124 alignment:10M2I10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGH.Q.D.LDV...L......EQE...G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2065 score:100 alignment:11M1S[2,1]7M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~QVSLDSNS.NSQNSNLNSQW~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1554 score:105 alignment:7M1I2M1S[1,2]10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.H..S...T.GL.D.G.GG...T....L...N.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1097_014 score:138 alignment:5M1S[2,2]3M1S[2,2]8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.DLV...L......E.....N...GE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2674_002 score:131 alignment:2M1D17M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~N.G.....T....L...D.....NDLMLLR.L.S.SP.A..TL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C565_003 score:133 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...L......A.....D...NE....QF.L.NAAR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1143_003 score:121 alignment:10M1S[2,2]8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...L......E.....N...GE....QF.L.NKGV~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2665 score:107 alignment:10M1I10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.H..P...G.L..D.S.SS..T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1299_009 score:110 alignment:8M1I1M1S[1,2]10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LVT.H..S...L.G..NDG.GG...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C220 score:97 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...L......N.....E...LV....DL.M.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1212_003 score:141 alignment:5M1S[2,2]2M1S[1,2]10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.H..P...F.N..D.G.GG...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1812_009 score:142 alignment:2M1S[3,3]15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGH.N.E.LDV...L......E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2133_006 score:140 alignment:9M1S[1,2]10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.H..P...N.F..G.D.GG...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1229_006 score:130 alignment:9M1S[1,2]10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.H..P...F.L..D.G.GG...T....L...D.....DDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C280_007 score:101 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...L......E.....D...VV....DL.M.DAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3082 score:119 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.H..P...G.L..D.T.C...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1791_004 score:117 alignment:2M1D17M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~N.G.....T....L...D.....NTLMLLR.L.T.SP.A..TL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1243_004 score:101 alignment:1S[2,2]8M1S[2,2]8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VAH.N.D.LEV...L......E.....N...GQ....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2615 score:115 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~T....L...D.....NDLMLLR.L.S.SP.T..GQLSR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1853_004 score:97 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLV.G..H...L.D..N.D.M...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3791 score:114 alignment:7M1I2M1S[1,2]10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.H..T...T.GV.D.G.GG...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C900_004 score:133 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.H..P...N.F..G.D.N...T....L...D.....NNLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C959_004 score:119 alignment:9M2I11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGH.Q.D.LEV...LGE....E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2508 score:124 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...N......E.....H...NV....DF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1054_003 score:120 alignment:1I9M1S[2,2]9M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SLTP.N..P...N.F..N.G.T...N....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1697_002 score:114 alignment:1I20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SLL.H..T...H.F..G.D.N...T....L...D.....NDLMLLK.L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C556_009 score:142 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...L......N.....G...NE....QF.L.NAAR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1216 score:127 alignment:1I7M1I1M1S[1,2]11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ALT.H..P...S.T..NDG.GG...T....L...D.....NDLMLLK.L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1541_003 score:115 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...L......E.....E...LG....ME.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1883_007 score:115 alignment:1I1S[2,2]2M1D5M1S[2,2]8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~NGLE.H...LDV...L......E.....N...GE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1506_003 score:131 alignment:9M1S[1,2]10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.H..P...N.F..G.D.GG...T....L...N.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2062_003 score:124 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LNG.H.E.LDV...L......E.....G...NQ....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1309_004 score:103 alignment:10M1S[2,2]8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LNG.H.E.LDV...L......E.....N...GE....QF.L.NGVK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2384 score:105 alignment:7M1I2M1S[1,2]10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.H..G...S.TL.D.G.GG...T....L...N.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3128 score:121 alignment:10M1S[2,2]8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...L......E.....N...GQ....QF.L.NGVK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1138_005 score:115 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.H..L...E.N..G.D.N...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1937_006 score:99 alignment:14M1D5M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~T....L...D.....NDLMLLR.L.S.SP....TQREK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1087_005 score:124 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...L......T.....E...LS....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2085_003 score:140 alignment:5M1S[1,2]14M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.H..P...GG.F..G.D.N...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C219 score:129 alignment:2M1S[3,3]5M2I10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGH.N.E.LDV...L......ELE...G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2506 score:124 alignment:2M1S[3,3]15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGH.N.E.LDV...L......E.....G...NE....QF.L.NAKV~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1267_004 score:116 alignment:10M1S[2,2]8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGH.Q.D.LDV...L......E.....N...GQ....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2284_004 score:131 alignment:9M1S[1,2]10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.H..P...A.D..N.D.GG...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3936 score:142 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LPE.H.N.LDV...L......E.....G...NQ....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2095_008 score:115 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~T....L...D.....NDLMLLR.L.S.SP.S..AQLSR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2951 score:125 alignment:8M1S[2,2]10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.H..P...F.L..D.N.G...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1012_016 score:158 alignment:13M1S[1,2]6M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...L......E.....G...NE....GAF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C790_016 score:127 alignment:1I20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLAL.H.N.PEV...L......E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C801_017 score:141 alignment:1I20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PLLL.H.N.LDV...L......E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_101 score:115 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...L......E.....T...LV....DM.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2216 score:144 alignment:9M1S[1,2]10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLN.H..P...N.F..D.G.GG...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C301_002 score:113 alignment:10M1D9M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...L......E.........NW....QF.L.NGVK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C261_003 score:106 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...N......N.....H...LV....DF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C183_021 score:133 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...L......E.....S...SE....MF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1583_004 score:106 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDP...T......H.....N...NQ....DF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3827 score:151 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...Q......E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C126_027 score:141 alignment:9M3I11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LEV...LNGE...E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C866_012 score:135 alignment:1S[2,2]8M4I10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AVE.H.N.LDV...L......EEGME.G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C310_022 score:116 alignment:10M1S[2,2]8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LEV...L......N.....N...GE....QF.L.NGVK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C671 score:99 alignment:8M1D11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.H..M...L.D..D...N...L....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C446 score:124 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LPE.H.N.LDV...L......N.....G...NE....QF.L.NGVK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C222_025 score:101 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LNG.H.E.LEV...L......N.....G...NE....QF.L.NGVK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_079 score:106 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...L......E.....T...LV....DL.M.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1432 score:144 alignment:9M1S[1,2]10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.H..P...N.F..D.G.GG...T....L...N.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C211_016 score:133 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...L......E.....P...SE....HF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1545 score:115 alignment:9M2I11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGH.Q.D.LDV...LNE....E.....G...NQ....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C315 score:96 alignment:3I7M1D12M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KFELFQ.E.N.GE....L......E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C314_002 score:106 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...V......N.....E...HN....DF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_096 score:138 alignment:10M2I10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LAE.H.N.LDV...L......ELE...G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C531_018 score:130 alignment:8M1D11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.H..P...N.F..D...N...D....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2089_007 score:115 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.H..G...L.D..N.D.E...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_085 score:155 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.H..P...N.F..D.G.N...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C301_003 score:106 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...N......E.....N...HV....DM.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C289_003 score:110 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...L......E.....E...LG....EF.L.NGVK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C274 score:120 alignment:10M2I10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGH.Q.E.LDV...L......ETE...G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C172_023 score:133 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...L......N.....N...NS....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1796 score:146 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LEV...L......N.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C367_007 score:130 alignment:10M1S[2,2]8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...L......N.....N...GE....QF.L.NAAR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C629 score:104 alignment:5M1D14M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.H..P.....F..H.T.Q...T....F...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C300_004 score:105 alignment:1I20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PLGE.H.N.LDV...L......E.....D...VV....DL.M.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C291_002 score:121 alignment:1I4M1D15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LNGE.H...LDV...L......E.....G...NE....QF.L.NAVK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C243_022 score:97 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...L......D.....E...HV....DL.M.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C250_021 score:145 alignment:13M4I7M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...L......E.....G...NEEGNEQF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1508 score:96 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLL.H..G...V.D..D.D.L...T....L...D.....DDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3813 score:133 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...L......E.....G...NE....QF.L.NGKV~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2388_004 score:135 alignment:9M1S[1,2]10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.H..P...D.F..G.D.GG...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C911_002 score:137 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.H..P...N.E..D.G.N...T....L...D.....NNLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C871_017 score:121 alignment:2M1S[2,2]16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGH.E.N.LDV...L......N.....G...NE....QF.L.NARA~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_049 score:102 alignment:5M1S[2,2]3M1S[2,2]8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LNG.H.E.DLV...L......E.....N...GQ....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1550 score:137 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLN.H..P...T.F..D.G.N...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_103 score:124 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.H..G...L.D..N.M.N...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1198_015 score:97 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~T....L...D.....NDLMLLR.L.S.SS.V..RVPSN~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C433_020 score:151 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...E......E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C204_002 score:92 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...L......N.....D...LV....DL.M.DAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C658_017 score:131 alignment:10M1S[2,2]6M1S[2,2] unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LEV...L......E.....N...GE....QF.L.NAKA~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C280_006 score:128 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGH.Q.D.LDV...L......Q.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C829_018 score:127 alignment:10M1S[2,2]6M1S[2,2] unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LAE.H.N.LDV...L......E.....N...GE....QF.L.NAKA~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1096_018 score:109 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.H..T...T.L..D.N.D...D....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C673_019 score:115 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...N......H.....E...NV....DF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1452 score:151 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...L......E.....G...NQ....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_056 score:101 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...L......E.....D...LV....DL.M.DAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C607 score:100 alignment:9M1S[1,2]2M2I8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLA.H..T...L.D..N.D.GG...T....LTM.D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C321_002 score:151 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LNV...L......E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C921_006 score:101 alignment:1I8M1D4M1S[1,2]6M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLGT.N..P...N.F..P...N...F....L...D.....GGDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C852_019 score:108 alignment:10M1S[2,2]6M1S[2,2] unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGH.Q.D.LEV...L......E.....N...GE....QF.L.NAKA~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C340_002 score:123 alignment:5M1S[2,2]13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LDG.H.Q.DLV...L......E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2046_003 score:132 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.H..P...F.L..D.G.N...T....L...D.....DDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1267_003 score:131 alignment:1I11M1S[2,2]7M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QLLL.H.N.LDV...L......E.....G...DQ....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_162 score:130 alignment:10M1S[2,2]8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...L......E.....N...GE....QF.L.NGVK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1471 score:121 alignment:1I4M1D15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LNGE.H...LDV...L......E.....G...NQ....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1407 score:115 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...L......E.....N...SV....QF.L.NGVK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3814 score:151 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...L......E.....G...NE....QF.L.NAVK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C795 score:142 alignment:5M1S[1,2]3M1S[1,2]10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.H..P...GG.F..D.G.GG...T....L...N.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2207_002 score:107 alignment:10M1I10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.H..P...G.P..D.D.SG..T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1099_007 score:120 alignment:9M1D3M1S[1,2]6M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.H..P...N.F..N.H.....T....F...D.....GGDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C546 score:123 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.H..G...Y.H..D.G.D...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2260_002 score:121 alignment:9M1S[1,2]2M3I8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.H..P...S.W..D.G.GG...T....LNTLD.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1177_009 score:139 alignment:9M1S[1,2]3M3I7M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.H..P...N.F..D.G.GG...T....L...DTLD..NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C616_015 score:114 alignment:5M1S[2,2]13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LQG.H.E.DLV...L......N.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C696_014 score:103 alignment:2M1S[2,2]16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGH.E.N.LDV...N......H.....E...NV....DF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C649 score:120 alignment:9M1S[1,2]1M4I9M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.H..P...F.L..D.G.GG...TGNDDL...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_102 score:153 alignment:9M1S[1,2]10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.H..P...N.F..D.G.GG...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C598_010 score:130 alignment:1I4M1D15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LNGE.H...LDV...L......E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C285_007 score:106 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...L......H.....N...LV....DM.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1087_008 score:108 alignment:4M1S[3,3]6M1S[1,2]6M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLV.P..N...F.P..N.F.D...T....L...D.....GGDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C383_013 score:97 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLA.H..T...L.D..N.D.N...S....E...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1447 score:138 alignment:7M1S[1,2]1M1S[1,2]10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.H..P...M.L..GG.G.GG...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C765 score:96 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLV.G..H...L.D..D.M.N...T....L...D.....DDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C548_013 score:98 alignment:10M1I10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~T....L...D.....NDLMLLGVL.S.SP.A..SAREK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C483_018 score:98 alignment:12M1S[2,2]6M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLA.H..P...L.S..D.D.E...T....L...N.....DDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C241_014 score:102 alignment:2I6M1D13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GGLGE.H.N.L.V...N......E.....H...NV....DF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1424 score:115 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LNG.H.E.LDV...L......E.....G...NE....QF.L.NGVK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1434 score:150 alignment:5M1S[2,2]13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.DLV...L......E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3131 score:135 alignment:9M1S[1,2]10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.H..P...M.L..D.G.GG...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2099_002 score:123 alignment:12M3I8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLN.H..P...T.F..D.G.N...T....LNTLD.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C272_016 score:111 alignment:1I9M1S[2,2]9M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GLGE.H.N.LDV...N......G.....E...HV....DF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C524_010 score:119 alignment:10M1I1M1S[1,2]8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGG.H.E.LDV...L......GS....G...GGE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2109 score:123 alignment:11M3I9M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLE.H..P...T.F..D.G.N...TANT.L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C621 score:106 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LNG.H.E.LDV...L......E.....Q...GD....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C520_013 score:134 alignment:10M1S[2,2]8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LEV...L......E.....N...GN....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1020_002 score:146 alignment:5M1S[1,2]3M1S[1,2]10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.H..P...GG.F..D.G.GG...T....L...D.....NELMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1073_002 score:137 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.H..P...F.L..D.G.N...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C866_008 score:101 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LEV...L......S.....E...LV....DM.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3654 score:133 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...L......E.....H...NV....DF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1450_002 score:141 alignment:10M3I10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LEV...L......ENEE..G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C483_017 score:98 alignment:1I4M1D15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LDGE.H...LEV...L......N.....P...NS....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3661 score:133 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...L......E.....Q...GD....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1399_005 score:102 alignment:1S[2,2]16M1S[2,2] unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VAE.H.N.LDV...L......E.....D...LV....DF.L.NAKA~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1676_007 score:128 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...L......E.....G...DE....QF.L.NKGV~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1453_002 score:106 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...N......N.....E...HV....DF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C706_018 score:144 alignment:11M1S[1,2]8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LEV...L......N.....G...GGE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1491 score:133 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LNG.H.E.LDV...L......E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C538_009 score:126 alignment:7M1S[1,2]12M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.H..P...T.T..GG.D.D...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C243_016 score:106 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...V......D.....E...HN....DF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3873 score:106 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...N......T.....E...LV....DF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C250_018 score:124 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...L......E.....N...LV....DF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1422_002 score:140 alignment:9M1S[1,2]10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLN.H..P...T.F..N.G.GG...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1271_016 score:93 alignment:2I7M3D10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~HTLLF.H..P...N.F..........T....L...D.....NDLPLVK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C242_022 score:142 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...L......E.....A...NH....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C981_002 score:109 alignment:5M1I4M1S[1,2]2M2I8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.H..PG..D.L..D.G.GG...T....LTM.D.....DDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C784_011 score:106 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...N......H.....N...LV....DF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C92_026 score:96 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.H..P...T.T..D.D.L...T....N...M.....DDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C940_003 score:110 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLA.H..P...L.S..D.D.M...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1396_007 score:115 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LVE.H.N.LDV...V......E.....G...NE....QF.L.NKVG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C78_022 score:123 alignment:9M3I11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LAG.H.D.LDV...LNGE...E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C706 score:141 alignment:10M3I10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LEV...L......EELE..G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C732_003 score:109 alignment:1I4M1D5M1S[2,2]8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LNGE.H...LDV...L......E.....N...GQ....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1440 score:111 alignment:5M1S[2,2]3M1S[2,2]8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LNG.H.E.DLV...L......E.....N...GE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C794_013 score:146 alignment:11M3I9M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...L......E.....GEEGNE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C898_003 score:126 alignment:1I1S[2,2]8M1S[2,2]8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PGLL.H.N.LDV...L......E.....N...GE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C850_004 score:112 alignment:9M1I11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.H..S...T.G..L.GDN...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1380 score:148 alignment:10M1S[2,2]8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...L......E.....N...GE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C731 score:124 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~T....L...D.....NDLMLLR.L.S.SP.A..SQLSR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2952 score:98 alignment:1I6M1D13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGLT.H..L...D....N.D.M...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C79_026 score:96 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLA.H..T...L.D..D.D.L...T....L...D.....DDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1549_017 score:121 alignment:2M1S[3,3]5M1S[2,2]8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGH.N.E.LDV...L......E.....N...GQ....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1510 score:151 alignment:5M1S[1,2]3M1S[1,2]10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.H..P...GG.F..D.G.GG...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_223 score:112 alignment:10M1S[2,2]8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LNG.H.E.LDV...L......E.....N...GQ....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C268_017 score:112 alignment:15M1I5M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...L......E.....G...AA....NHML.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C685_002 score:144 alignment:10M5I10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...L......ETNGEEG...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1458 score:143 alignment:9M1S[2,2]9M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.H..P...N.F..D.G.T...N....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2229_002 score:107 alignment:17M1I3M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~G.N...T....L...D.....NDLMLLR.L.S.NL.RN.TLD~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C78_020 score:142 alignment:10M2I10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LEV...L......EEQ...G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1450 score:153 alignment:9M1S[1,2]10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.H..P...D.F..N.G.GG...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C966_008 score:139 alignment:10M1S[2,2]8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...L......E.....N...GQ....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C76_020 score:135 alignment:10M5I10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LAE.H.N.LDV...L......ENGDEEG...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C782_002 score:105 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.H..G...L.E..D.D.L...T....L...D.....DDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C74_022 score:142 alignment:10M2I10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.D.LDV...L......ELE...G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C62_012 score:128 alignment:10M1I3M1D6M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...L......EQ....G...NE.....F.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C71_024 score:145 alignment:10M4I10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...L......EEGNE.G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C734_002 score:106 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...L......D.....H...LV....DM.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C73_029 score:105 alignment:1I4M1D4M2I1M1S[2,2]8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LNGE.H...LDV...LNL....E.....N...GE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1372 score:111 alignment:1I7M1S[2,2]10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KLT.H..L...D.D..D.N.G...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1509 score:112 alignment:1I8M1S[1,2]10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KLT.H..L...D.N..D.G.GG...T....L...N.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C559_006 score:114 alignment:1I19M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KLT.H..L...D.N..D.G.N...T....L...N.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1360 score:125 alignment:1I9M1S[2,2]8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GVE.H.N.LEV...L......E.....N...GE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2649_002 score:119 alignment:19M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~G.N...T....L...D.....DELMLLK.S.T.LP.A..TL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C443_008 score:107 alignment:19M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SC.AAAGTEC.LLS.GG.EG.SKR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C309_007 score:107 alignment:19M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SC.AAAGTEC.LLS.GW.AS.AAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C614_004 score:98 alignment:19M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...L......E.....N...AD....LK.M.NAA~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2069_004 score:102 alignment:1I6M1I4M3I9M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TLT.H..P...S.TV.D.G.N...TANT.L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1614_006 score:101 alignment:2I1M1S[2,2]16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VGLH.T..L...S.D..N.G.D...T....L...D.....DDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C641_005 score:133 alignment:1I19M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~NGE.L.N.LDV...L......E.....G...NQ....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1428_004 score:94 alignment:1I17M1S[2,2] unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VGE.H.N.LDV...L......E.....H...LV....DM.L.NAKA~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C749_004 score:122 alignment:3I19M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QAGGG.N.N.LDV...L......Q.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1489 score:151 alignment:1I19M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~MYPGQLT..GNMLCVGFLEGGK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1273 score:89 alignment:1I8M1D10M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KLT.H..H...D.D..D.E.....T....L...D.....DDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1425 score:123 alignment:1I19M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VGH.Q.D.LEV...L......E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C500_007 score:119 alignment:1I19M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~EGN.N.V.LEV...L......E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1445 score:124 alignment:1I19M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KGF.E.N.LDV...L......E.....G...NQ....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1187 score:105 alignment:15M1S[1,2]3M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SC.AAAGTES.ELS.GG.EGG.TKG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1121_004 score:147 alignment:1I4M1S[1,2]3M1S[1,2]10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VLT.H..P...GG.F..N.G.GG...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1007_002 score:93 alignment:1I4M1S[2,2]3M1S[2,2]8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~NGH.L.E.DLV...L......E.....N...GQ....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1260_004 score:123 alignment:2I19M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KGRF.L.N.LDV...L......E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C721_004 score:118 alignment:2I19M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~EPGD.G.Q.LEV...L......E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1484 score:115 alignment:1I19M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VGE.H.N.LDV...K......E.....S...MS....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3784 score:120 alignment:1I4M1S[2,2]3M1S[2,2]8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VGE.H.Q.DLV...L......E.....N...GE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2474 score:115 alignment:1I19M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VGE.H.N.LDV...L......E.....N...LV....DF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1877_003 score:111 alignment:1I6M1I13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TLT.H..P...G.TD.N.G.D...T....L...D.....DDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1860_005 score:128 alignment:1I19M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VLT.H..P...F.Q..D.G.N...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C477_009 score:97 alignment:1I19M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~EGL.H.N.LDV...L......E.....T...LV....DM.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1147_003 score:140 alignment:1I8M1S[1,2]10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QLL.H..P...N.F..N.G.GG...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3660 score:97 alignment:1I19M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VGE.H.N.LDV...L......E.....H...LV....DL.M.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2210_002 score:134 alignment:1I9M1S[2,2]8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VGE.H.N.LEV...L......E.....N...GE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C966_007 score:98 alignment:2I5M1D13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TGLL.H..L...D....N.M.N...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1204 score:98 alignment:19M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~T....L...D.....NDLMLLR.L.S.SV.E..QLRN~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1247_004 score:110 alignment:1I19M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TLV.H..P...L.S..D.M.N...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1221_002 score:107 alignment:1I7M1I4M3I8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SLT.H..P...S.T..NDG.N...T....LSTLD.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1416 score:121 alignment:1I8M1S[1,2]10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KLT.H..L...D.N..D.G.GG...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1387_006 score:105 alignment:14M1D4M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SC.AAAGTES.ELS.GW..N.TKG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C217_018 score:104 alignment:8M1I11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GE.H.N.LDV...NG.....E.....H...NL....DF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C165_020 score:98 alignment:2I8M1D10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VGLT.H..P...N.E..D.Q.....T....L...N.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1401 score:125 alignment:1I9M1S[2,2]8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VGE.H.N.LEV...L......E.....N...GQ....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C775 score:115 alignment:1I19M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KLT.H..G...L.D..N.D.N...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C787 score:119 alignment:1I19M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VLN.H..P...D.F..G.D.N...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C144_025 score:110 alignment:1I4M1I4M4I11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GGV.H.DALDV...LTNGE..E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_097 score:133 alignment:1I19M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KGF.E.N.LDV...L......E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C612 score:101 alignment:1I19M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VLV.H..T...L.D..N.D.D...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1412 score:123 alignment:1I19M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KLT.H..L...D.N..D.G.N...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C755 score:89 alignment:1I5M1D13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VLQ.H..L...D....D.M.N...T....L...D.....DDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C77_022 score:116 alignment:3M1I1M1S[2,2]13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GQ.HLD.DLV...L......E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C77_021 score:129 alignment:1I8M6I11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VGE.H.N.LEV...LTENNGEE.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_219 score:120 alignment:2I8M1S[1,2]10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AGLT.H..L...D.N..D.G.GG...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1190 score:106 alignment:2I1M1S[2,2]16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VGLH.T..L...S.D..D.G.N...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1220 score:124 alignment:1I19M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VLT.H..P...E.F..G.D.N...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C288_009 score:142 alignment:1I19M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PGE.H.Q.LDV...L......E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C247_019 score:132 alignment:1I8M3I11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VGE.H.N.LEV...LSEL...E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1123_002 score:105 alignment:1I6M1I6M5I7M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ALT.H..P...T.TD.N.G.N...T....L...DGNTLNNDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C225_016 score:124 alignment:1I19M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VGE.H.N.LDV...L......E.....N...LS....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C261_017 score:104 alignment:1I2M1I6M3I1M1S[2,2]8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SGEVH.A.LDV...LGNE...E.....N...GE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1670_009 score:133 alignment:1I6M1S[1,2]1M1S[1,2]10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VLN.H..P...D.F..GG.G.GG...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1425_009 score:116 alignment:1I9M1S[2,2]8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GVE.H.N.LEV...L......E.....N...GQ....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1347_007 score:125 alignment:19M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...L......E.....G...NE....QF.R.NPL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_920 score:146 alignment:1I19M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VGE.H.N.LEV...L......E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2094_004 score:113 alignment:14M1I5M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~T....L...D.....NDLMLLR.L.S.SPSA..QLRS~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1384_007 score:107 alignment:19M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SC.AAAGTES.ELS.GW.GS.AKG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1569_007 score:114 alignment:2I19M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AGPS.E.N.LDV...L......E.....G...NQ....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1563_010 score:124 alignment:1I19M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~NGN.E.V.LDV...L......E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1261_009 score:133 alignment:1I19M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KGF.D.N.LDV...L......E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C444_002 score:111 alignment:1I6M1I13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TLT.H..P...G.SE.N.G.D...T....L...D.....DDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C406_002 score:119 alignment:1I19M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VGE.H.N.LDV...K......E.....G...DY....DF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1428 score:98 alignment:19M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SC.AAAGTES.ELS.GW.GS.AAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_077 score:142 alignment:1I19M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VGE.H.Q.LDV...L......E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_057 score:106 alignment:1I19M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VGE.H.N.LDV...L......E.....H...LV....DM.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C869_021 score:111 alignment:1I4M1S[2,2]3M1S[2,2]8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VGE.H.Q.DLV...L......E.....N...GQ....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1115_012 score:141 alignment:1I19M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VGE.H.N.LEV...L......E.....G...DE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C941_017 score:95 alignment:3M1I1M1S[2,2]3M1S[2,2]8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GQ.HLD.DLV...L......E.....N...GQ....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C545_018 score:116 alignment:1I17M1S[2,2] unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GVE.H.N.LEV...L......E.....G...NE....QF.L.QAKA~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C173 score:137 alignment:1I9M3I10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KGE.H.N.LDV...L......EENE..G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C202 score:107 alignment:2I3M1D15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VNGE.H...LEV...L......E.....G...NE....QF.L.NGVK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_024 score:134 alignment:19M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...L......E.....G...NE....QF.L.NRK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1417_012 score:126 alignment:4M1I15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GL.H.NDLEV...L......E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1199_007 score:99 alignment:1I5M1D13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KLT.H..H...D....N.D.M...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C678_012 score:120 alignment:1I1M1S[3,3]5M2I10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KGH.N.E.LDV...L......ELE...G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1184_017 score:107 alignment:1I7M1I4M3I8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VLT.H..P...S.T..NDG.N...T....LNTLD.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C611_020 score:137 alignment:1I19M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VGE.H.N.LEV...L......E.....G...NQ....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C190 score:141 alignment:12M1S[1,2]6M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GE.H.N.LDV...L......Q.....G...NE....GAF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1834_004 score:118 alignment:1I19M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VGH.Q.D.LEV...L......E.....G...DE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1439 score:116 alignment:19M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SC.AAAGTEC.LLS.GW.GS.AAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1039_012 score:123 alignment:1I4M1S[2,2]13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GVE.H.Q.DLV...L......E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C262_002 score:94 alignment:1I15M1I4M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VGE.H.N.LDV...L......N.....G...TL....VD.LMNAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C722_023 score:110 alignment:1I19M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VGE.H.N.LEV...N......E.....H...NV....DF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C704_017 score:110 alignment:1I1M1S[3,3]4M3I11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VGH.N.E.LDV...LTEL...E.....G...NQ....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1157_015 score:100 alignment:3M1I6M1S[2,2]8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GV.HQD.LEV...L......E.....N...GQ....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C543 score:113 alignment:2I19M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VGLT.H..L...S.D..D.G.D...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C590 score:124 alignment:1I19M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VLT.H..P...T.T..N.M.N...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3935 score:102 alignment:9M1I6M1S[1,2]3M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SC.AAAGTECHLLS.GG.EGG.SKL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C254_024 score:125 alignment:1I7M3I2M1S[2,2]8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VGE.H.N.LDVGNEL......E.....N...GE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C600 score:137 alignment:1I19M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VLT.H..P...E.F..D.G.N...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C300_016 score:125 alignment:2I3M1D15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VNGE.H...LEV...L......E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C117_025 score:138 alignment:1I9M2I10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VGE.H.N.LDV...L......EEE...G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C189_029 score:136 alignment:1I9M4I10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VGE.H.N.LDV...L......ENGEE.G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_075 score:95 alignment:1I4M1D14M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ASC.AA.GTEC.LLS.GW.GS.AAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1203_020 score:122 alignment:1I8M1S[1,2]10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VLT.H..P...T.T..N.M.GG...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3800 score:89 alignment:19M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LR.H..T...L.D..N.D.M...L....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3870 score:110 alignment:1I19M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GVE.H.N.LEV...L......E.....G...NE....QF.L.NGKV~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1142_008 score:98 alignment:19M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SC.AAAGSEC.LLS.GG.MN.SVK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1219 score:143 alignment:19M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~G.N...T....L...D.....NDLMLLR.L.S.SP.A..TL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1724_002 score:118 alignment:1I4M1S[2,2]13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GVE.H.Q.DLV...L......E.....G...DE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3785 score:124 alignment:1I19M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GVE.H.N.LDV...L......E.....G...NE....QF.L.NARA~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3085 score:111 alignment:1I9M1S[2,2]8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VGH.Q.D.LEV...L......E.....N...GE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C539_011 score:140 alignment:1M1S[2,2]16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GH.E.N.LDV...L......E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2445_003 score:138 alignment:1I4M1S[1,2]3M1S[1,2]10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KLN.H..P...GG.F..N.G.GG...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1441_004 score:141 alignment:2I19M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GDLE.H.N.LDV...L......E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3954 score:110 alignment:1I7M1I1M1S[1,2]10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VLT.H..S...L.G..NDG.GG...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3021 score:94 alignment:2I7M1D11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AGLT.H..H...T.Q..N...N...T....F...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1875_007 score:108 alignment:1I9M1D9M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GVE.H.N.LEV...L......E.........NW....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1029_004 score:100 alignment:2I3M1S[1,2]5M1S[2,2]8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KGDY.A.GG.LDV...L......E.....N...GQ....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C924_002 score:119 alignment:1I19M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VGE.H.N.LEV...L......E.....G...NE....QF.L.NGKV~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2845 score:132 alignment:1I4M1S[2,2]13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VGE.H.Q.DLV...L......E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1063 score:107 alignment:19M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SC.AAAGTES.ELS.GW.GG.SKA~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2244_002 score:119 alignment:1I6M1I2M1S[1,2]10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TLT.H..P...T.GD.N.G.GG...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1204_009 score:114 alignment:1I6M1I2M1S[1,2]10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TLT.H..P...S.GE.D.G.GG...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1343_014 score:102 alignment:1I9M1S[2,2]8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VGH.Q.D.LEV...L......E.....N...GQ....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2006_006 score:114 alignment:1I6M1I2M1S[1,2]10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ALT.H..P...F.GV.D.G.GG...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1135_004 score:89 alignment:19M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SC.AAAGTEC.LLS.SR.SC.AAA~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C986 score:95 alignment:14M1D1S[2,2]2M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SC.AAAGTES.ELS.GW...SQKG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1184_009 score:119 alignment:1I19M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VGE.H.N.LEV...L......E.....G...NE....QF.L.NKGV~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_988 score:137 alignment:1I19M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GVE.H.N.LEV...L......E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1239_005 score:142 alignment:15M1S[2,2]2M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GE.H.N.LDV...L......E.....G...NE....QF.L.GQAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1877_008 score:98 alignment:2I5M1D13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AGLT.H..H...D....N.D.M...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2740 score:135 alignment:1I8M1S[1,2]10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VLT.H..P...E.F..D.G.GG...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1395 score:141 alignment:2I19M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VGEE.H.N.LDV...L......E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1726_008 score:101 alignment:1I19M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KLT.H..G...L.N..D.D.L...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C979_006 score:140 alignment:1I8M1S[1,2]10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VLT.H..P...E.F..N.G.GG...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C711_002 score:113 alignment:2I19M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VGLT.H..L...S.D..D.G.N...T....L...D.....DDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3016 score:119 alignment:1I7M1I1M1S[1,2]10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TLT.H..P...T.G..NDG.GG...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1134_008 score:103 alignment:2I1S[2,2]16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PTH.E.N.LDV...L......E.....N...AD....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C553_004 score:135 alignment:18M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SC.AAAGTEC.LLS.GW.GN.TR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C897_014 score:117 alignment:18M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGQ.D.H.LDV...L......E.....G...NE....QF.L.NA~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C815_024 score:106 alignment:2I18M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PVE.H.N.LDV...L......E.....S...GH....MF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1435_003 score:87 alignment:8M2D2M1S[2,2]4M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L.S.SP.A..TLN...VASLPLSR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1219_004 score:141 alignment:3I18M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KATE.H.N.LDV...L......E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C602_005 score:87 alignment:1I4M1D13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ASC.AA.GTES.ELS.GW.GT.QK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C444_006 score:130 alignment:18M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~E.H.N.PEV...L......E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1394_007 score:114 alignment:5M1S[2,2]8M1S[1,2]2M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SC.AAAASCA.LLS.GW.GGG.TK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2848 score:115 alignment:2I18M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VVE.H.N.LDV...L......E.....G...NE....QF.L.NKVG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1348_003 score:114 alignment:2I3M1S[2,2]13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VPE.H.Q.DLV...L......E.....G...NS....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1394_006 score:115 alignment:15M1S[1,2]2M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SC.AAAGSDS.LLS.GW.GGG.TK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1040_005 score:110 alignment:5M2I1S[2,2]11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PGQLTMM..NGYLCVGFLEGGK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C454_006 score:114 alignment:1I15M1S[1,2]2M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GSC.AAAAASC.LLS.GW.GGG.TK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3835 score:110 alignment:2I18M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PTE.H.N.LDV...L......E.....A...LN....EF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C546_009 score:116 alignment:15M1S[2,3]1M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SC.AAAGTET.DLS.GW.GGSAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C542_016 score:111 alignment:1I1S[3,3]4M3I11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KH.N.E.LDV...LTEL...E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C549_007 score:106 alignment:15M1S[1,2]2M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SC.AAASESS.LLS.GW.GGG.TK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C494_007 score:116 alignment:15M1S[2,2]1M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SC.AAAGTES.ELS.GW.G.SQK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C830_019 score:96 alignment:2I3M1S[2,2]13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~APE.H.Q.DLV...L......E.....N...SS....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3853 score:133 alignment:2I18M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VPE.H.N.LDV...L......E.....G...NQ....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1641 score:106 alignment:5M1D12M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SC.AAA.TEC.LLS.FN.GN.TK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C723_014 score:128 alignment:2I8M3I10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SVE.H.N.LDV...L......ETME..G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1404_012 score:115 alignment:2I18M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TPE.H.N.LDV...L......E.....N...AD....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C221_005 score:116 alignment:15M1S[2,2]1M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SC.AAAGTEC.LLS.VM.G.SQK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1108_002 score:91 alignment:1I4M1D8M1S[1,2]4M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ASC.AA.GTEC.LLS.GAM.NS.VK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1481 score:126 alignment:18M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SC.AAAGTEC.LLS.GW.GT.QK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1118_005 score:103 alignment:5M1D8M1I4M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SC.AAA.TEC.LLS.GGFGN.TK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1124_005 score:99 alignment:18M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SC.AAASSNC.LLS.VM.GN.TK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C743_006 score:115 alignment:2I18M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PTE.H.N.LDV...L......E.....A...LE....DF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1174_013 score:130 alignment:2I1S[2,2]16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PTH.E.N.LDV...L......E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1189_003 score:132 alignment:3I18M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KATE.H.N.LDV...L......Q.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1423 score:113 alignment:1I4M1D10M1S[2,2]1M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ASC.AA.GTEC.LLS.GW.G.SQK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C129_010 score:129 alignment:13M1S[1,2]1M1S[2,2]1M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SC.AAAGTEC.LLS.GAM.G.SQK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C224_014 score:110 alignment:4M1D13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TC.AA.GTEC.LLS.GW.GN.TR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C171_012 score:121 alignment:12M1I3M1S[1,2]2M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SC.AAAGTEC.LLSMGS.GGG.TK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1635_005 score:129 alignment:1I18M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VE.H.Q.LEV...L......E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C166_017 score:116 alignment:1I18M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GSC.AAAAASC.LLS.GW.GN.TK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C190_024 score:97 alignment:5M2D11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SC.AAW..EC.LLS.GW.GN.TR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C177_021 score:142 alignment:15M1S[1,2]2M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SC.AAAGTEC.LLS.GW.GGG.TK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C901_003 score:124 alignment:2I18M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PTE.H.N.LDV...L......E.....A...ND....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3010 score:124 alignment:15M1S[1,2]2M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SC.AAAGTES.ELS.GW.GGG.TK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C312_008 score:135 alignment:18M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SC.AAAGTEC.LLS.GW.GQ.TK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1464 score:99 alignment:18M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SC.AAADHGC.LLS.GW.GS.RK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C377_008 score:86 alignment:8M2D5M1S[1,2]2M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SC.AAWESE...LS.GW.GGG.TK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1125_013 score:112 alignment:2I8M1S[2,2]8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VVE.H.N.LDV...L......E.....N...GQ....QF.L.NAVK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1400_009 score:115 alignment:2I18M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VVE.H.N.LDV...L......E.....G...QQ....DF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C414_006 score:90 alignment:18M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SC.AAASCAA.ALS.GW.GN.TR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1717_008 score:115 alignment:2I18M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PTE.H.N.LDV...L......E.....A...LD....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3079 score:103 alignment:8M2D6M1S[2,2] unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L.S.SP.A..TLN...VATVSLRP~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2725 score:93 alignment:8M2D4M2S[2,2] unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L.S.SP.A..TLN...VATVTVRP~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1170_008 score:115 alignment:2I18M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VVE.H.N.LDV...L......E.....G...NE....QF.L.NKGV~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2847 score:97 alignment:8M2D8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L.S.SP.A..TLN...VATVSRPL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C274_017 score:97 alignment:15M1S[1,2]2M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SC.AAASCAA.ALS.GW.GGG.TK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1287_005 score:123 alignment:1I4M1D13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ASC.AA.GTEC.LLS.GW.GN.TK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1482 score:123 alignment:16M1I2M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SC.AAAGTEC.LLS.GW.GGATK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C310_006 score:97 alignment:15M1S[1,2]2M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SC.AASQESS.LLS.GW.GGG.TK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C205_008 score:112 alignment:13M1S[1,2]4M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SC.AAAGTEC.LLS.GAM.NS.VK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C893_013 score:124 alignment:2I18M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VVE.H.N.LDV...L......E.....G...NQ....QF.L.NAVK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1506_007 score:95 alignment:2I11M1D6M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PLE.H.N.LDV...L......E.....E...HM.....F.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1407_008 score:103 alignment:2I1S[2,2]16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PTH.E.N.LDV...L......E.....Q...GD....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2519 score:132 alignment:2I9M1S[2,2]7M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PTE.H.N.LDV...L......E.....G...QD....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2668 score:97 alignment:2I18M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PTE.H.N.LDV...L......E.....A...LV....CM.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C774_011 score:101 alignment:2I18M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VVE.H.N.LEV...V......E.....G...NE....QF.L.NGKV~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C70_015 score:107 alignment:2I1S[2,2]5M3I11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ARH.E.A.LDV...LGNE...E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C566_005 score:112 alignment:13M1S[1,2]4M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SC.AAAGTET.LLS.GAM.GS.RK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C793_009 score:124 alignment:2I18M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VVE.H.N.LDV...L......E.....G...NE....QF.L.NAKV~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C68_025 score:107 alignment:1I18M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VE.H.N.LDV...L......E.....Q...LV....DF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C89_023 score:108 alignment:18M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SC.AAAGTES.ELS.GW.GS.RK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C220_012 score:99 alignment:18M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SC.AAAGTEC.LLS.SD.ML.TR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1108_007 score:111 alignment:1I18M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KE.V.M.EEV...L......E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C268_019 score:106 alignment:2I8M1S[2,2]1M3I3M1S[2,2]2M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SVE.H.N.LDV...L......E.....N...GENLS.QF.L.GQAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3136 score:106 alignment:15M1S[1,2]2M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SC.AAASCAA.LLS.GW.GGG.TK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C195_009 score:139 alignment:13M1S[1,2]4M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SC.AAAGTEC.LLS.GAM.GN.TK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C189_011 score:101 alignment:5M1D8M1I1M1S[1,2]2M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SC.AAA.TEC.LLS.GGFGGG.TK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C879_015 score:123 alignment:3I18M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KTEA.H.N.LDV...L......E.....G...NQ....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C334_007 score:105 alignment:1I4M1D13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ASC.AA.GTEC.LLS.GW.GT.QK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2943 score:115 alignment:8M2D8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L.S.SP.A..TLN...VATVSLPR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1425_014 score:122 alignment:15M2I3M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~T....L...D.....NDLMLLR.L.S.SP.ASRTLN~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C651_003 score:99 alignment:18M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SC.AAAGTET.LLS.TM.GL.TR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1697 score:99 alignment:18M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.H..P...N.F..N.G.N...T....L...N.....SHTTL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_028 score:142 alignment:2I18M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PVE.H.N.LDV...L......E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_999 score:135 alignment:18M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...L......E.....G...NE....QM.L.NA~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1246_002 score:127 alignment:13M1S[2,2]3M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.H..P...N.F..D.G.N...T....L...D.....DNLML~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_025 score:126 alignment:18M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SC.AAAGTES.ELS.GW.GN.TK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C847_003 score:79 alignment:3M4D11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LS.L......NSSGSS.YPSLL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C130 score:116 alignment:14M1S[2,2]2M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~E.Q.H.LDV...L......E.....G...NE....QF.L.GQAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1117 score:93 alignment:4I12M2D4M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DGHCAAGTEC.LLS.GW.G...KSGV~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1195 score:144 alignment:18M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...L......E.....G...NE....QF.L.NA~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2221 score:96 alignment:10M1I8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~CGGSLLNSQGEVVSAACGW~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1760_004 score:102 alignment:3I4M1I14M unique:True
~~~~~~~~~~~~ALNCTYNLSVPYQVSLNSGS.HF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C990_003 score:137 alignment:2I18M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VVE.H.N.LDV...L......E.....G...NE....QF.L.DAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C995_002 score:128 alignment:2I8M3I10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ALE.H.N.LDV...L......ETLE..G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1133 score:125 alignment:9M1S[1,2]6M1S[2,2] unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.H..P...N.F..D.G.GG...T....L...D.....NDLLM~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1426 score:116 alignment:15M1S[2,3]1M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SC.AAAGTES.ELS.GW.GGSAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1965_002 score:139 alignment:18M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.H..P...N.F..D.G.N...T....L...D.....NDLML~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2147_003 score:120 alignment:9M1S[1,2]6M1S[2,2] unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.H..P...N.F..D.G.GG...T....L...D.....DDLLM~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C493 score:128 alignment:2I18M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TPE.H.A.LEV...L......E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C666_006 score:105 alignment:14M1I4M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SC.AAAGTET.LLS.GSMGN.TR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C537 score:115 alignment:2I18M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PTE.H.N.LDV...L......E.....A...LN....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2413 score:126 alignment:1I16M1S[2,2] unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GLLT.H..P...N.F..D.G.N...T....L...D.....NDLLM~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C277_002 score:128 alignment:2I8M3I10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VVE.H.N.LDV...L......ETEE..G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1198 score:124 alignment:2I18M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~NRE.E.N.LDV...L......M.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_213 score:144 alignment:18M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SC.AAAGTEC.LLS.GW.GN.TK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C772 score:117 alignment:18M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SC.AAAGTES.ELS.GW.GQ.TK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C239 score:105 alignment:1I15M1S[1,2]2M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GSC.AAASCAA.LLS.GW.GGG.TK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1652 score:134 alignment:15M1S[2,2]1M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SC.AAAGTEC.LLS.GW.G.SQK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C819 score:101 alignment:4M1D13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TC.AA.GTCA.LLS.GW.GN.TK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1132 score:124 alignment:2I18M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TPE.H.N.LDV...L......E.....A...NN....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_015 score:105 alignment:14M1I4M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SC.AAAGTEC.LLS.GGEGS.RK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_059 score:142 alignment:2I18M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VPE.H.N.LDV...L......E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C316 score:130 alignment:1I8M2I10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VE.H.N.LDV...L......ELE...G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C258_002 score:104 alignment:1I4M1D10M1S[2,3]1M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ASC.AA.GTQC.LLS.GW.GGSAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3129 score:142 alignment:2I18M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~APE.H.N.LDV...L......E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_938 score:124 alignment:2I18M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~NEV.H.A.LDV...L......E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_078 score:108 alignment:18M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SC.AAAGTES.ELS.GW.GT.QK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C279 score:97 alignment:15M1S[1,2]2M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SC.AAGSEGS.LLS.GW.GGG.TK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C247 score:129 alignment:1I8M3I10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VE.H.N.LDV...L......EELE..G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1812_003 score:115 alignment:7M1S[1,2]10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.H..P...N.F..GG.G.N...T....L...D.....NDPLV~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C336 score:99 alignment:18M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SC.AAAGTES.ELS.GW.SQ.AK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1589_006 score:104 alignment:9M1I5M1I1M1S[1,2]2M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SC.AAAGDECHLLS.GGEGGG.TK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C581_002 score:112 alignment:2I7M1S[1,2]10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VRT.H..L...D.N..D.G.GG...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C435_004 score:105 alignment:8M2D2M1S[2,2]4M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L.S.SP.A..TLN...VASLSLPR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C247_006 score:97 alignment:12M1D5M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SC.AAAGTEC.LLS..W.ME.TR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C379_009 score:129 alignment:2I8M2I10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~NVE.H.N.LDV...L......ELE...G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C256_006 score:132 alignment:8M1S[2,2]8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~E.H.N.LDV...L......E.....N...GE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C193_009 score:104 alignment:14M1I1M1S[2,2]1M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SC.AAAGTEC.LLG.GGYG.SQK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C634_003 score:121 alignment:13M1S[1,2]4M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SC.AAAGTET.LLS.GAM.GN.TR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C194_006 score:104 alignment:1I4M1D8M1S[1,2]4M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ASC.AA.GTEC.LLS.GAM.GD.KK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2513 score:97 alignment:3I17M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TTFH.N.LDV...L......E.....A...QN....DF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1749_002 score:113 alignment:17M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLN.H..P...T.F..N.G.N...T....L...D.....DDLM~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C942_006 score:110 alignment:13M1S[2,2]2M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DDLMLLR.L.S.SP.A..TNLSR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3086 score:131 alignment:5I17M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TCTTSH.N.LDV...L......E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1548_009 score:97 alignment:3I17M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QLTH.N.LDV...L......E.....A...TQ....QM.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C373_005 score:107 alignment:3I7M1S[2,2]8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VNGH.E.LEV...L......E.....N...GE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C812_018 score:97 alignment:3I17M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QLTH.N.LDV...L......E.....S...GH....MF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2750 score:79 alignment:1I3M3D11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LTAV...VNWVQQTLAAN
>C2601_005 score:133 alignment:3I17M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TTFH.N.LDV...L......E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1962_012 score:119 alignment:5I7M1S[2,2]8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DSCTSH.N.LDV...L......E.....N...GE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1180 score:131 alignment:17M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.H..P...N.F..D.G.N...T....L...D.....NDLM~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1043_005 score:90 alignment:1I17M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KE.H.N.LDV...L......E.....G...NE....QN.G.EQF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1356 score:106 alignment:9M1S[1,2]7M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LTL.H..P...N.F..D.G.GG...T....L...D.....DDLM~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_724 score:131 alignment:17M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...L......E.....G...DE....QF.L.N~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2471_002 score:112 alignment:3I7M1S[2,2]8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TTFH.N.LDV...L......E.....N...GQ....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C846_006 score:83 alignment:1I7M2D8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VS.TP.A..TLN...VATVSRPL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3080 score:100 alignment:17M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...L......E.....Q...QG....DF.L.N~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C391 score:106 alignment:3I17M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QTLH.N.LDV...L......E.....G...HS....MF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1799_006 score:100 alignment:17M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~T....L...D.....NDLSWLK.T.L.SP.A..TL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1895_010 score:131 alignment:5I17M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DCTSSH.N.LDV...L......E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_875 score:136 alignment:17M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...L......E.....G...NE....QF.L.N~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1192_004 score:113 alignment:17M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LTL.H..P...N.F..D.G.N...T....L...D.....NDLM~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1260_007 score:121 alignment:5I8M1S[2,2]7M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TCTTSH.N.LDV...L......E.....G...QD....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1272 score:126 alignment:17M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.H..P...N.F..D.G.N...T....L...D.....DDLM~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1457_004 score:107 alignment:2I17M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VVE.H.N.LDV...L......E.....G...NE....QF.L.LRD~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1190 score:136 alignment:17M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.H..P...N.F..N.G.N...T....L...D.....NDLM~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_996 score:86 alignment:3M2D7M1S[2,2]3M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VDL...H.N.LDV...L......E.....N...GE....QF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1579_006 score:131 alignment:5I17M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DSCTSH.N.LDV...L......E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1068 score:106 alignment:3I17M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QTLH.N.LDV...L......E.....G...SH....MF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C707_016 score:101 alignment:2I2M1S[2,2]3M3I10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KQH.E.DLV...L......ENEE..G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C597_014 score:119 alignment:3I17M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~NDVH.A.LEV...L......E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3918 score:102 alignment:3I2M1S[2,2]3M1S[2,2]8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~NDLH.A.DLV...L......E.....N...GE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2660 score:134 alignment:16M1S[1,2] unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...L......E.....G...NE....QF.L.GG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1016 score:127 alignment:17M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~T....L...D.....NDLMLLR.L.S.SP.A..TL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2195 score:125 alignment:16M1S[1,2] unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LNE.H.N.LDV...L......E.....G...NE....QF.L.GG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1949_007 score:113 alignment:5I8M1S[3,3]6M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DCTSSH.N.LDV...L......E.....G...QN....EF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C709_012 score:106 alignment:3I7M2I10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AHLQ.D.LDV...L......ELE...G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C846_003 score:122 alignment:17M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DDLMLLR.L.S.SP.A..TLNSR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1137_002 score:110 alignment:3I17M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VNGH.E.LEV...L......E.....G...NQ....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_809 score:97 alignment:1I4M1D12M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QLND.H...LDV...L......E.....G...NE....QF.L.N~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1454_004 score:117 alignment:2I2M1I15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PAH.NDLEV...L......E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1410 score:127 alignment:17M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SSGSS.YPSLLQC..LK.VPV~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2514 score:97 alignment:3I17M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QTLH.N.LDV...L......E.....S...GH....MF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1451 score:124 alignment:3I17M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TTFH.N.LDV...L......E.....G...NQ....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1183_014 score:85 alignment:1I17M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KE.H.N.LDV...L......E.....G...NE....EN.G.EQG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1098_002 score:101 alignment:3I17M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QTLH.N.LDV...L......E.....V...DV....DF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C299_014 score:88 alignment:1I13M1S[1,2]3M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~MAAAGTEC.LLS.GG.EGG.SVK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C620_013 score:113 alignment:2I7M1S[2,2]8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DAH.N.LDV...L......E.....N...GQ....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C693 score:102 alignment:3I7M2I10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DVHQ.A.LDV...L......ELE...G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1456_006 score:91 alignment:1I7M2D2M1S[2,2]4M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VS.TP.A..TLN...VASLSLPR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_924 score:133 alignment:3I17M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QTLH.N.LDV...L......E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1442 score:109 alignment:17M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SC.AAAGTEC.LLS.GW.CL.R~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1809_003 score:97 alignment:3I17M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QTLH.N.LDV...L......E.....A...QN....DF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1448 score:89 alignment:2I17M unique:True
~~~~~~~~~~~MPYQPYQV.SLPYQVSLNSG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2555 score:129 alignment:9M1S[1,2]7M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.H..P...N.F..D.G.GG...T....L...D.....NDLM~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1260 score:108 alignment:17M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LTL.H..P...N.F..D.G.N...T....L...D.....DDLM~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3855 score:123 alignment:3I8M1S[2,2]7M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QTLH.N.LDV...L......E.....G...QD....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C308_002 score:106 alignment:3I7M2I10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VPHQ.D.LDV...L......ELE...G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2180 score:94 alignment:2I16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KTS.R..P...Y.F..D.G.N...T....L...D.....NDLML~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C659_007 score:72 alignment:3M4D9M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DTM......S.SP.A..TLNSR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2065_002 score:83 alignment:16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SSGSS.YPSLLQG..PH.DM~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1223_006 score:106 alignment:3I6M3I10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~RYQD.LDV...L......ETSE..G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2177_003 score:83 alignment:16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KRTELVNWVQQTLAAN
>Combined_2947 score:107 alignment:6M1S[2,2]8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~N.LDV...L......E.....N...GE....QF.L.NAVK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1498_006 score:104 alignment:1I16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KLA.H..P...E.F..D.G.N...T....L...D.....NDLM~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C212 score:106 alignment:3I5M3I11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KYND.LDV...LTEL...E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1847_006 score:97 alignment:1I12M1S[2,2]2M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DLL.H..P...T.F..N.G.N...T....L...D.....DNLM~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C880_004 score:101 alignment:16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~N.LDV...L......E.....G...NE....QF.L.NKGV~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2186 score:107 alignment:3I16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ALRRLQL.H.N.LDV...L......E.....G...NE....QF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1462_004 score:115 alignment:4I16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~RKYLN.LDV...L......E.....G...NQ....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2615 score:114 alignment:4I16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AAYND.LEV...L......E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1417_007 score:83 alignment:16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KVDRLVNWVQQTLATN
>C1540_006 score:110 alignment:16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~N.LDV...L......E.....G...NE....KM.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1473_003 score:107 alignment:3I16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DALH.N.LDV...L......E.....G...NE....QF.L.GEA~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1125 score:101 alignment:13M1S[3,3] unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DLMLLR.L.S.SP.A..TLSRN~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C975_018 score:107 alignment:14M1S[2,2] unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DLMLLR.L.S.SP.A..TLNRS~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1441 score:96 alignment:16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DLMLLR.L.S.SP.A..TGKER~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C691_009 score:106 alignment:4I16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QQNGQ.LDV...L......E.....G...NQ....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C920_020 score:116 alignment:14M1S[2,2] unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~N.LDV...L......E.....G...NE....QF.L.NAKA~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C3054_002 score:124 alignment:4I16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~RNTDN.LDV...L......E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_100 score:107 alignment:13M1S[2,2]1M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DLMLLR.L.S.SP.A..TLSNR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1506_005 score:83 alignment:16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~N.LDV...L......E.....P...SE....DF.L.GAQK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1019_004 score:101 alignment:16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~N.LDV...L......E.....G...QQ....DF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C673_004 score:105 alignment:4I12M1S[2,2]2M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SPQEN.LNV...L......E.....G...NE....QF.L.GQAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1015_020 score:83 alignment:16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SSGSS.YPSLLQG..PD.HM~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1208_003 score:89 alignment:3I16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DNAH.LDV...L......E.....Q...GN....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1568_005 score:107 alignment:3I6M2I10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~RYND.LDV...L......ETE...G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2608 score:87 alignment:16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~N.LDV...L......N.....V...DV....QF.L.NAVK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C957_018 score:110 alignment:16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DLMLRL.L.S.SP.A..TLNSR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1465_004 score:115 alignment:4I16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DRDVN.LDV...L......E.....G...NQ....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_923 score:124 alignment:4I16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KAFDN.LDV...L......E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C955_014 score:84 alignment:7M1I9M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AATGDDNMLLS.GW.GN.TK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C276_025 score:100 alignment:1I16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~MAAAGTMT.LLS.GW.GN.TR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_163 score:116 alignment:13M1S[2,2]1M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DLMLLK.L.S.SP.A..TLSNR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C392 score:100 alignment:1I16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VGQ.E.H.LDV...L......E.....G...NE....QF.L.N~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2662 score:110 alignment:16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~N.LDV...L......E.....G...NE....QF.L.NAKV~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C531_003 score:95 alignment:6M1S[2,2]5M1S[2,2]1M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DLMLLR.S.L.SP.A..TLSNR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C208 score:97 alignment:3I12M1S[2,2]2M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DNAH.LDV...L......Q.....G...NE....QF.L.GQAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1537 score:115 alignment:3I16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KYQD.LEV...L......E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C255_011 score:107 alignment:3I16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DNAH.LDV...L......E.....G...NS....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3816 score:124 alignment:4I16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KAYQN.LDV...L......E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C491_006 score:106 alignment:8M1S[2,2]2M1S[2,2]2M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~N.LDV...L......E.....G...NQ....EF.L.GQAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2472 score:116 alignment:6M1S[2,2]8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~N.LDV...L......E.....N...GE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2800 score:105 alignment:5I16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SPDNGQ.LDV...L......E.....G...NQ....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C919_002 score:110 alignment:16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DLMLLK.L.S.SP.A..TSNLR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C579_004 score:124 alignment:4I16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ADLNN.LDV...L......E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1444_009 score:110 alignment:6M1S[3,3]7M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~N.LDV...L......E.....E...GN....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2471 score:119 alignment:16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~N.LDV...L......E.....G...NQ....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2505 score:115 alignment:3I16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KYED.LEV...L......E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1254_007 score:102 alignment:5I6M1S[2,2]8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SRDTLN.LDV...L......E.....N...GQ....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3883 score:116 alignment:8M1S[2,2]6M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~N.LDV...L......E.....G...NQ....EF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C238_012 score:116 alignment:3I16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DNAH.LDV...L......E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1415 score:107 alignment:12M1S[2,2]2M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DLMLLR.L.S.SP.A..TNLSR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C247_018 score:88 alignment:1I12M1I4M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~MAAAGTEC.LLS.GGEGS.RK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C780_017 score:106 alignment:7M1S[2,2]5M1S[2,2] unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~N.LDV...L......E.....G...DQ....QF.L.NAKA~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C238_023 score:104 alignment:4I5M4I11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~MPPGD.LDV...LGNGN..E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3109 score:100 alignment:1I16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~MAAAGTES.ELS.GW.GN.TR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1052_003 score:92 alignment:16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KVDRLVNWVQQTLAAN
>C890_019 score:106 alignment:3I5M3I11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VYQD.LDV...LTEL...E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C193 score:101 alignment:12M1S[3,3]1M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DLMLLR.L.S.SP.A..TNSLR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_018 score:109 alignment:1I16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~MAAAGTES.ELS.GW.GN.TK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C986_007 score:101 alignment:16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~N.LDV...L......E.....G...NE....QF.L.NKVG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3903 score:125 alignment:3I16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KYEN.LDV...L......E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C583_005 score:89 alignment:12M1I4M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~N.LDV...L......E.....G...NM....GS.LLNAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2732 score:101 alignment:16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DLMLLR.L.S.SP.A..TLRSN~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3836 score:107 alignment:3I16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KYEN.LDV...L......E.....A...ND....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C558_003 score:101 alignment:12M1S[3,3]1M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DLMLLR.L.S.SP.A..TSLNR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1832_005 score:128 alignment:16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...L......E.....G...NE....QF.L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C752_006 score:92 alignment:16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DLMLLR.L.S.SP.A..SQLSR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2554_005 score:114 alignment:5I16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KAFTLN.LDV...L......E.....G...NQ....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_052 score:128 alignment:16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~N.LDV...L......E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C885_016 score:120 alignment:3I16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~RYEN.LEV...L......E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3852 score:118 alignment:7M1S[2,2]7M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~N.LDV...L......E.....G...DQ....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1233_007 score:98 alignment:3I16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KDME.ELV...L......E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1454_007 score:115 alignment:4I16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KAYQN.LDV...L......E.....G...NQ....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2513 score:119 alignment:16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~N.LDV...L......E.....G...NE....QF.L.NAVK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C505 score:101 alignment:16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GQLQGLVSWGYGPGMK~~~~~~~~~~~~~~~~~~~~~~
>Combined_050 score:119 alignment:16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DLMLLR.L.S.SP.A..TLNSR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C433_008 score:107 alignment:3I16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DNAH.LDV...L......Q.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2101_002 score:90 alignment:10M1S[2,2]3M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LDE.H.N.LDV...L......E.....N...GQ....QF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1747_007 score:85 alignment:1I1S[2,1]13M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ENTLLNENW.VVTAAH~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1950_003 score:90 alignment:10M1S[2,2]3M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LPQ.H.N.LDV...L......E.....N...GE....QF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C989_006 score:79 alignment:15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~CGGSLLNENW.VVDRN~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1371 score:108 alignment:10M1S[2,2]3M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...L......E.....N...GE....QF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1142_011 score:79 alignment:15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TSGSS.YPSLLQW..MG.Y~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1697_003 score:100 alignment:2I15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VTL.H..P...E.F..N.G.N...T....L...D.....NDLM~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1077 score:83 alignment:15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~CGGSLLNEDW.VVTHF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C933_019 score:96 alignment:2M1S[2,2]6M1S[2,2]3M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGH.E.N.LDV...L......E.....N...GE....QF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2286 score:80 alignment:1I10M1S[2,2]3M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~NLDH.A.N.LDV...L......E.....N...GE....QF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1639_006 score:89 alignment:4I15M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KSGGVSSGSS.YPSLLCA..LK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_860 score:111 alignment:15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LNE.H.N.LDV...L......E.....G...NE....QF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1204_011 score:85 alignment:3I15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KNMF.LEV...L......E.....G...NE....QF.L.NSR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3972 score:93 alignment:15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~N.LDV...L......E.....G...NE....QF.L.RDL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3104 score:110 alignment:1S[2,2]13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~MANYVNWLQQTLAAN
>C1259_011 score:84 alignment:15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SSGSS.YPSLLQH..MH.M~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C902 score:115 alignment:5I15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~FSFMALDV...L......E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1440_010 score:97 alignment:15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...L......N.....G...QE....EF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1350_013 score:94 alignment:4I1S[2,2]3M1S[2,2]8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~MKYQDLV...L......E.....N...GE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1292_010 score:87 alignment:1I15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GLGE.H.N.LDV...L......E.....S...SM....EF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1427 score:108 alignment:5M1S[2,2]8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LDV...L......E.....N...GE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C694_002 score:79 alignment:15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LDV...L......E.....D...VD....VF.L.DAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C793 score:93 alignment:15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~N.LDV...L......E.....G...NE....QF.L.RLD~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C734 score:93 alignment:15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LDV...L......E.....D...GQ....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_083 score:84 alignment:15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GQLQGLVSWGYPSMR~~~~~~~~~~~~~~~~~~~~~~~
>C624 score:83 alignment:10M1D2M1S[2,2] unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TSGSS.YPSLL.C..LA.K~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1408_008 score:88 alignment:15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...L......E.....S...SM....EF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1772 score:88 alignment:2I10M1S[2,2]3M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GPLSD.H.N.LDV...L......E.....N...GE....QF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_726 score:120 alignment:15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...L......E.....G...NE....QF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1342_011 score:82 alignment:1S[2,2]3M1S[2,2]8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AVD.H.Q.DLV...L......E.....G...NE....QF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1604_002 score:111 alignment:15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LAE.H.N.LDV...L......E.....G...NE....QF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1560_003 score:108 alignment:9M1S[2,2]4M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...L......G.....E...NE....QF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_837 score:83 alignment:15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~CGGSLLNENW.VVTHF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2497 score:110 alignment:1S[2,2]13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AVE.H.N.LDV...L......E.....G...NE....QF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2358 score:98 alignment:1I10M1S[2,2]3M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GLNE.H.N.LDV...L......E.....N...GE....QF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1844_011 score:84 alignment:15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SSGSS.YPSLLQR..MS.Y~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3084 score:84 alignment:15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SSGSS.YPSLLQK..DM.Y~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2383_004 score:98 alignment:3I15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AAYHFCGGSLLNENW.VVT~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1893_003 score:102 alignment:15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LEQ.H.N.LDV...L......E.....G...NE....QF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1866_007 score:83 alignment:1I15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ALNE.H.N.LDV...L......E.....Q...GD....QF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1848_002 score:118 alignment:2I15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ALE.H.N.LDV...L......E.....G...NE....QF.L.N~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3637 score:115 alignment:15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...L......E.....G...DE....QF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_725 score:99 alignment:10M1S[2,2]3M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LNE.H.N.LDV...L......E.....N...GE....QF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1681_002 score:102 alignment:9M1S[3,3]3M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...L......G.....N...EE....QF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2040_003 score:111 alignment:15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LPE.H.N.LDV...L......E.....G...NE....QF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1010_003 score:106 alignment:13M3I2M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...L......E.....G...NENGE.QF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1126 score:86 alignment:2I2M1D7M1S[2,2]3M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PGLG..H.N.LDV...L......E.....N...GE....QF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2913_002 score:79 alignment:15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VTALVNWVQETLAAN
>C399_011 score:102 alignment:15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LDV...L......E.....G...NE....QF.L.NGVK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1466 score:102 alignment:5M1S[3,3]7M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LDV...L......E.....E...GN....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C653_011 score:81 alignment:8M1S[2,2]5M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~N.LDV...L......E.....G...NQ....EF.L.RDL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1445_003 score:99 alignment:5M1S[2,2]8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LDV...L......E.....N...GQ....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1118_004 score:111 alignment:4I15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KMEFLEV...L......E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2775 score:97 alignment:15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~F..D.G.N...T....L...D.....NDLMLRL.L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1659 score:111 alignment:15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LDV...L......E.....G...NQ....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_016 score:120 alignment:15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LDV...L......E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1434_002 score:111 alignment:4I15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KTCFLEV...L......E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C661_004 score:102 alignment:4I15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LSRMEEV...L......E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2249 score:92 alignment:2M1S[3,3]6M1S[2,2]2M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGN.E.H.LDV...L......E.....G...DQ....QF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C402_007 score:102 alignment:15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LDV...L......E.....G...NE....QF.L.GAQK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1764_007 score:95 alignment:7I15M unique:True
~~~~~~~~~~~MVPYQSNL.SVPYQVSLNSGS.HF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3123 score:120 alignment:15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VCNYVNWLQQTLAAN
>C1977_003 score:98 alignment:2I2M1D12M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PGLG..H.N.LDV...L......E.....G...NE....QF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_058 score:118 alignment:11M1S[1,2]3M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...L......E.....G...GGE....QF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_061 score:88 alignment:10M1D2M1S[2,2] unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SSGSS.YPSLL.C..LA.K~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1609_002 score:82 alignment:4M1D10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SGR.V.CGGSLLNSQW~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C184 score:93 alignment:15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LDV...L......E.....G...QQ....DF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2904 score:95 alignment:1M1S[1,2]13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~F..GG.G.D...T....L...D.....NDLMLRL.L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1398 score:108 alignment:7M1S[2,2]6M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LDV...L......E.....G...NQ....EF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1830_003 score:84 alignment:15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SSGSS.YPSLLQW..MG.Y~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1260_003 score:84 alignment:15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SSGSS.YPSLLQW..GM.Y~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1119 score:98 alignment:4I15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KSGGVSSGSS.YPSLLAC..LK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C547_004 score:84 alignment:15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SSGSS.YPSLLQA..AM.K~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2440 score:79 alignment:15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~CGGSLLNENW.VVFHT~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C954_002 score:101 alignment:1I15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KGCS.YPSLLQC..LK.VPV~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2524 score:80 alignment:1I2M1D12M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~FTG..HFCGGSLLNENW~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_051 score:102 alignment:15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGD.H.Q.LDV...L......E.....G...NE....QF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1288 score:84 alignment:15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VTALVNWVQQTLAAN
>Combined_1443 score:110 alignment:11M1S[2,2]2M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LDV...L......E.....G...NE....QF.L.GQAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1445_006 score:94 alignment:14M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~F..N.G.N...T....L...D.....NDLRLLF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_029 score:85 alignment:14M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SSGSS.YPSLLQT..SR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_030 score:75 alignment:14M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TTGSS.YPSLLQT..SR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_092 score:112 alignment:14M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...L......E.....G...NE....Q~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C602_006 score:97 alignment:3I7M1S[2,2]5M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ADLH.N.LDV...L......E.....N...GE....QF.L.N~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1593_008 score:91 alignment:3I14M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VDHQ.A.LDV...L......E.....G...NE....QF.L.N~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_062 score:105 alignment:1M1S[1,2]12M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~F..GG.G.D...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2354_003 score:95 alignment:2M1I12M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TCHAAAGTEC.LLS.GW~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C918_005 score:88 alignment:1I14M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SGR.DLSSGSS.YPSLL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C476_009 score:76 alignment:14M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SQW.VVSAAHHEHYR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_934 score:112 alignment:14M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~F..N.G.N...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1055 score:89 alignment:14M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TSGSS.YPSLLCA..LK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2973 score:76 alignment:14M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VTALVNWVQQTLAA
>C2325 score:80 alignment:14M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SC.AAAGDDT.HLS.GW~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C80 score:94 alignment:14M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LAD.H.N.LDV...L......E.....G...NE....Q~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C437_007 score:90 alignment:2M1S[2,2]10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TTSGS.YPSLLQC..LK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_080 score:107 alignment:14M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TSGSS.YPSLLQC..LK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1755_005 score:75 alignment:14M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TTGSS.YPSLLNV..MK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1428_003 score:89 alignment:5I14M unique:True
~~~~TVTNHLVGGYTDAAN.SVPY~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_071 score:112 alignment:14M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.H..P...N.F..N.G.N...T....L...D.....N~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2694 score:92 alignment:2I14M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GPLD.H.N.LDV...L......E.....G...NE....QF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C790_004 score:98 alignment:14M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~EAGSS.YPSLLQC..LK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1066 score:84 alignment:14M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TSGSS.YPTLLQM..AK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1217 score:85 alignment:14M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SSGSS.YPSLLQM..MM~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2993 score:83 alignment:2I14M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AGKY.V.N.LDV...L......E.....G...NE....QF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C3045 score:80 alignment:2I9M1S[2,2]3M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~NGDQ.H.N.LDV...L......E.....N...GE....QF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C839_004 score:89 alignment:14M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.H..P...M.L..D.G.N...T....L...D.....N~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C843_005 score:103 alignment:14M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DLMLLR.L.S.SP.A..TLN~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C584_002 score:80 alignment:14M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TSGSS.YPSLLNV..MK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C584 score:97 alignment:8M1S[2,2]4M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~F..D.G.N...T....L...D.....NLDMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_031 score:107 alignment:14M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~F..D.G.N...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_084 score:97 alignment:3M1S[2,2]9M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~F..D.G....SQ....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C545 score:85 alignment:14M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SSGSS.YPSLLGT..WK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1588_002 score:89 alignment:2I9M1S[2,2]3M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GSGL.H.N.LDV...L......E.....N...GE....QF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2004_005 score:94 alignment:14M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~F..G.D.N...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2667 score:103 alignment:14M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SSGSS.YPSLLAC..LK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1798_004 score:85 alignment:14M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SSGSS.YPSLLQS..TR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_990 score:112 alignment:14M unique:True
~~~~~~~~~~~~~~~~~~~~SLPYQVSLNSGS.HF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1893_008 score:80 alignment:14M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TSGSS.YPSLLQS..TR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C958 score:95 alignment:2M1S[2,2]10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~F..D.N.G...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C142_021 score:94 alignment:14M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SSGSS.YPSLLCA..LK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1208 score:81 alignment:2M1I12M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GTFHFCGGSLLNENW~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1074 score:80 alignment:14M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TSGSS.YPSLLQR..ST~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_148 score:100 alignment:1M1S[2,2]11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LEG.H.N.LDV...L......E.....G...NE....Q~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2031_006 score:85 alignment:14M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SSGSS.YPSLACL..LK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1735_011 score:98 alignment:5I14M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SRMEELV...L......E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1072 score:76 alignment:14M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SSGSS.YPSLLGK..TW~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C665_007 score:98 alignment:14M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~F..N.G.D...T....L...D.....NNLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2565 score:85 alignment:14M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SSGSS.YPSLLQR..ST~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1291_006 score:100 alignment:2M1S[2,2]10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~F..N.N.G...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3826 score:105 alignment:9M1S[1,2]4M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.H..P...N.F..D.G.GG...T....L...D.....N~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C913_016 score:100 alignment:7M1S[2,2]5M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~F..N.G.N...T....L...D.....DNLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_026 score:112 alignment:14M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SSGSS.YPSLLQC..LK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2949 score:85 alignment:14M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SSGSS.YPSLLNV..MK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1822 score:75 alignment:14M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GGSLLNENW.VVTHF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1786_005 score:95 alignment:7M1S[2,2]5M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~F..D.G.N...T....L...D.....DNLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1103 score:75 alignment:14M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TTGSS.YPSLLQS..TR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C289 score:105 alignment:3I8M1S[1,2]4M1S[1,2] unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ALDH.N.LDV...L......E.....G...GGE....QF.L.GG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C564_006 score:94 alignment:14M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SSGSS.YPSLLQW..SK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1881_005 score:81 alignment:1I9M1S[2,2]3M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KGF.E.N.LDV...L......E.....N...GE....QF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C437_017 score:102 alignment:1S[2,2]12M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AVE.H.N.LDV...L......E.....G...NE....Q~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C398_019 score:100 alignment:1S[2,2]12M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GLE.H.N.LDV...L......E.....G...NE....Q~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C833_003 score:107 alignment:14M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.H..P...N.F..D.G.N...T....L...D.....N~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1458_003 score:85 alignment:14M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LDV...L......E.....G...NE....QF.L.REL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2335_006 score:85 alignment:14M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SSGSS.YPSLLQD..MY~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C376 score:97 alignment:7M1S[2,2]5M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TSGSS.YPTVLQC..LK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_160 score:102 alignment:14M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TTGSS.YPSLLQC..LK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1735_004 score:88 alignment:1I12M3I2M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GVE.H.N.LDV...L......E.....G...NEGNE.QF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1945_002 score:76 alignment:14M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SSGSS.YPSLLAS..QW~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1790_003 score:89 alignment:2I9M1S[2,2]3M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GALE.H.N.LDV...L......E.....N...GE....QF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1110_002 score:90 alignment:1M1S[2,2]11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~F..G.N.D...T....L...D.....DDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2116_007 score:93 alignment:1S[2,2]12M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LDMLLR.L.S.SP.A..TLN~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C497_004 score:97 alignment:3I7M1S[2,2]5M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ALDH.N.LDV...L......E.....N...GE....QF.L.N~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1487_003 score:83 alignment:2I14M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AGDV.H.A.LDV...L......E.....G...NE....QF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1212 score:86 alignment:13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~G.N...T....L...D.....NDLMLRL.L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_825 score:104 alignment:13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~N.LDV...L......E.....G...NE....QF.L.N~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2083_002 score:90 alignment:2I8M1S[2,2]3M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VEE.H.N.LDV...L......E.....N...GE....QF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1258_004 score:101 alignment:3I13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~FMWNYVNWLQQTLAAN
>Combined_1196 score:102 alignment:2I13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VPE.H.N.LDV...L......E.....G...NE....QF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1118 score:104 alignment:13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~S.HFCGGSLLNSQW~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C719_003 score:92 alignment:2M1S[2,2]9M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLL.K.S.SP.A..TLNSR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3024 score:76 alignment:1I13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DSGSS.YPSLLQS..TR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1501_004 score:92 alignment:8M1S[2,2]3M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~E.H.N.LDV...L......E.....N...GE....QF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2047_003 score:76 alignment:1I13M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GN.D.T...F....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1014_002 score:98 alignment:1I13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AT.HFCGGSLLNSQW~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1015_003 score:89 alignment:4M1S[2,1]7M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~T.HFCNSLLNSQW~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1726_005 score:88 alignment:2I11M3I2M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SVE.H.N.LDV...L......E.....G...NENGE.QF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1715_004 score:81 alignment:2I8M1S[2,2]3M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~EAL.H.N.LDV...L......E.....N...GE....QF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1140 score:86 alignment:13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DLMLRL.L.S.SP.A..TL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1986_004 score:85 alignment:1I13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KSGSS.YPSLLQM..AK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2956 score:87 alignment:4M1I9M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~D.G.N...TF...L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1065_002 score:90 alignment:2I8M1S[2,2]3M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VVE.H.N.LDV...L......E.....N...GE....QF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2522 score:76 alignment:1I13M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~YN.S.L...T....L...D.....NDLTLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1005 score:77 alignment:13M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~N.S.L...T....L...D.....NDLTLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1791_005 score:87 alignment:3M1I10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~D.G.NF..T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2515 score:92 alignment:6M1S[2,2]5M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~N.LDV...L......E.....N...GE....QF.L.N~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1621 score:88 alignment:2I11M3I2M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SVE.H.N.LDV...L......E.....G...NEGNE.QF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1456_004 score:85 alignment:1I13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~NS.QWCGGSLLNSQW~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C977_002 score:88 alignment:1I4M1S[2,1]7M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AT.HFCNSLLNSQW~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_945 score:95 alignment:13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~G.N...T....L...D.....NDLMLLR.L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C386 score:85 alignment:1I13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~NSGSS.YPSLLQS..WK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C595_008 score:86 alignment:13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SSGSS.YPSLLQW..R~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C768_004 score:104 alignment:13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLK.L.S.SP.A..TLNSR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2066_005 score:80 alignment:1I13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~NSGSS.YPTLLQM..AK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1728_007 score:98 alignment:1I13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AEGSS.YPSLLQC..LK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C3061_002 score:81 alignment:2I8M1S[2,2]3M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~NEL.H.N.LDV...L......E.....N...GE....QF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1204_008 score:86 alignment:13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SSGSS.YPSLLQR..W~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_940 score:95 alignment:13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DLMLLR.L.S.SP.A..TL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C802 score:82 alignment:1I1S[1,2]12M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~T  GG.G.D...F....L...D.....DDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_995 score:92 alignment:1S[2,2]11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~H.SFCGGSLLNSQW~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1154_003 score:91 alignment:1I1S[1,2]6M1S[2,2]4M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~S  GG.G.N...T....L...D.....NVEMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1797 score:98 alignment:1I13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SD.G.N...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2487 score:104 alignment:13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~NYVNWLQQTLAAN
>Combined_1815 score:85 alignment:13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~CGGSLLNENW.VVT~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2405 score:104 alignment:13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SSGSS.YPSLLQC..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2395 score:90 alignment:2I8M1S[2,2]3M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VPE.H.N.LDV...L......E.....N...GE....QF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1191 score:103 alignment:1I13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SS.HFCGGSLLNSQW~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C3250_003 score:93 alignment:2I13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~WGG.N...T....L...D.....NDLMLLR.L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1136 score:85 alignment:13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~CGGSLLNEDW.VVT~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C822 score:82 alignment:4M1I9M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~D.G.N...TF...L...D.....DDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C680_006 score:87 alignment:1I1S[1,2]12M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~T  GG.G.D...F....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1563_005 score:94 alignment:1I13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GSSSS.YPSLLQC..LK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2451 score:90 alignment:13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~G.N...T....L...D.....DDLMLLR.L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C236_004 score:74 alignment:11M1S[2,2] unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LSS.L.S.SP.A..TLNRS~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_037 score:96 alignment:12M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...L......E.....G...N~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_783 score:96 alignment:12M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.H..P...N.F..N.G.N...T....L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1047 score:87 alignment:12M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LL.L.S.SP.A..TLNSR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1383 score:86 alignment:1I12M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GSSSS.YPSLLQC..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1194_003 score:93 alignment:3I12M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QLTH.N.LDV...L......E.....G...NE....QF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C860 score:77 alignment:12M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~HFCGGSLLDENW~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1798_008 score:79 alignment:3I12M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DAHL.D.LDV...L......E.....G...NE....QF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C414_007 score:87 alignment:12M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~G.N...T....L...D.....NNLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1721_012 score:81 alignment:3I7M1S[2,2]3M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~NPLH.N.LDV...L......E.....N...GE....QF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1579_009 score:79 alignment:3I12M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~HQLD.N.LDV...L......E.....G...DE....QF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3647 score:84 alignment:4M1S[2,2]6M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~G.N...T....L...N.....DDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2486 score:94 alignment:2I12M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AMG.N...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_937 score:96 alignment:12M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~YVNWLQQTLAAN
>Combined_3130 score:84 alignment:5M1S[2,2]5M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~G.N...T....L...D.....DNLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1498_011 score:79 alignment:3I12M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ADVH.Q.LDV...L......E.....G...DE....QF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C327_014 score:78 alignment:12M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~G.N...T....L...D.....NNNMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_817 score:93 alignment:3I12M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PVDH.N.LDV...L......E.....G...NE....QF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2659 score:82 alignment:12M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~HFCGGSLLNEMW~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C664_007 score:78 alignment:12M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~G.N...T....L...D.....ENLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2494 score:91 alignment:5I12M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DMDTSH.N.LDV...L......E.....G...NE....QF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1011 score:79 alignment:3I12M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AAYHFCGGSLLNENW~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C795_007 score:73 alignment:12M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~G.N...T....L...D.....DDMLLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_852 score:93 alignment:3I12M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TTFH.N.LDV...L......E.....G...NE....QF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_855 score:80 alignment:4I7M1S[2,2]3M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ATTRH.N.LDV...L......E.....N...GE....QF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2069_002 score:81 alignment:1I12M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~FHFCGGSLLNENW~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2483 score:92 alignment:2I1M1S[1,2]10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AMG.GG...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1176_008 score:77 alignment:1I12M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AG.N...T....L...G.....NTLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C81 score:87 alignment:12M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.A.LDV...L......E.....G...N~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2464 score:84 alignment:1M1S[2,2]9M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LEG.H.N.LDV...L......E.....G...N~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2709 score:74 alignment:1I9M1S[2,2]1M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~RLL.L.S.SP.A..TLSNR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2440_003 score:94 alignment:2I12M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PMG.N...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1859_003 score:83 alignment:1I7M1S[2,2]3M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QH.N.LDV...L......E.....N...GE....QF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1344_003 score:81 alignment:6M1S[2,2]4M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~G.N...T....L...D.....DLDMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1687_002 score:86 alignment:1I12M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QYVNWLQNTLAAN
>C1515_006 score:78 alignment:12M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GSS.YPSLLQS..WK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2322 score:93 alignment:3I12M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DALH.N.LDV...L......E.....G...NE....QF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2562 score:81 alignment:3I7M1S[2,2]3M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QDLH.N.LDV...L......E.....N...GE....QF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_901 score:86 alignment:1I12M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~RLL.L.S.SP.A..TLNSR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1127 score:72 alignment:3M1S[2,1]7M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~HFCNSLLNENW~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_027 score:96 alignment:12M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~G.N...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C588_010 score:77 alignment:11M1S[1,2] unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~HFCGGSLLNENMA~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1305_003 score:84 alignment:8M1S[2,2]2M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~G.N...T....L...D.....NDLLMLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1566_003 score:73 alignment:12M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~G.N...T....L...D.....DDLRLTK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1482_006 score:77 alignment:12M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GGSLLNENW.VVT~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1900_003 score:93 alignment:3I12M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QTLH.N.LDV...L......E.....G...NE....QF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1957_004 score:95 alignment:1I12M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QH.N.LDV...L......E.....G...NE....QF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2509 score:91 alignment:3M1S[1,2]8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~YVNMALQQTLAAN
>C240_007 score:96 alignment:12M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SSGSS.YPSLLQC~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1721_003 score:81 alignment:3I7M1S[2,2]3M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DPLH.N.LDV...L......E.....N...GE....QF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1320_002 score:91 alignment:12M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.H..P...N.F..D.G.N...T....L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2302_004 score:89 alignment:2I12M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PMG.N...T....L...D.....DDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C688_003 score:78 alignment:12M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~G.N...T....L...D.....NTLMLLR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C662_005 score:96 alignment:12M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GSS.YPSLLQC..LK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1710 score:92 alignment:2I1M1S[1,2]10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PMG.GG...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1268_007 score:73 alignment:12M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~YVNWLQETPSAN
>Combined_048 score:91 alignment:12M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~G.N...T....L...D.....DDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C612_004 score:78 alignment:12M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~G.N...T....L...D.....NDLMVLR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_805 score:82 alignment:12M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~HFCGGSLLNENW~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1334_002 score:90 alignment:1I12M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GLLT.H..P...N.F..D.G.N...T....L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1530_004 score:79 alignment:11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~MLCVGFLEGGR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2278 score:83 alignment:11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VNWLEQTLAAN
>Combined_1444 score:76 alignment:4M1S[2,2]5M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~N...T....L...D.....DNLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2140_008 score:70 alignment:11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~T....L...D.....NDLMLRL.L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C817_005 score:86 alignment:2I11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DVSS.YPSLLQC..LK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1295_013 score:68 alignment:2M1S[2,2]4M1S[2,1]1M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~MLAMGFLENK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_762 score:83 alignment:11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DSR.VATVSLPR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C870 score:70 alignment:11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L.NAPTLLT.H..P...N~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1399 score:78 alignment:8M1S[2,1]1M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~MLCVGFLENK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3797 score:88 alignment:11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LNSQW.VVSAAH~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3639 score:76 alignment:6M1S[2,2]3M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~N.LDV...L......E.....N...GE....QF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2566 score:74 alignment:11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~T....L...D.....DDLMLLR.L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2965 score:84 alignment:4I11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KVYQN.LDV...L......E.....G...NE....QF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1530_006 score:88 alignment:11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~T....L...D.....NDLMLLK.L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1027_010 score:78 alignment:7M1S[2,2]2M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~N.LDV...L......E.....G...DQ....QF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1822_007 score:74 alignment:11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VNWVEQTLAAN
>Combined_1411 score:70 alignment:11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~T....L...D.....NDLMLLL.R~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2780 score:73 alignment:1S[2,3]1S[1,2]8M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AAAAMLQQTLAAN
>Combined_926 score:83 alignment:11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VDWLQQTLAAN
>Combined_1505 score:88 alignment:11M unique:True
~~~~~~~~~~~~~~~~~~~~SLPYQVSLNSG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2461 score:77 alignment:1I1S[1,2]10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KGLLLT.H..P...N.F..D.G.N~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2005 score:74 alignment:11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VDWVQQTLAAN
>Combined_1087 score:79 alignment:11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~K.VPVLSDSSCK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_941 score:79 alignment:11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~T....L...D.....NDLMLLR.L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C966_005 score:74 alignment:2M1S[1,2]8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LVGL.L.S.SP.A..TLN~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1295_003 score:70 alignment:11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~CGGSLLNSQM.S~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_819 score:84 alignment:4I11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SRFEN.LDV...L......E.....G...NE....QF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C175_015 score:88 alignment:11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~E.....G...NE....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_821 score:88 alignment:11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~N.LDV...L......E.....G...NE....QF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C177_009 score:78 alignment:11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~K.L.T.TP.A..TLNSR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_877 score:88 alignment:11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VNWLQQTLAAN
>C2128_002 score:73 alignment:1I11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GVNWVEQTLAAN
>Combined_1283 score:73 alignment:1I11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~WFCGGSLLNENW~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1242 score:71 alignment:3M1I8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~K.L.TLSP.A..TLNSR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1405 score:85 alignment:3I11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ALDH.N.LDV...L......E.....G...NE....Q~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1429 score:70 alignment:11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~MLCVGFLEAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_616 score:77 alignment:2I11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ALVNWVQQTLAAN
>Combined_2955 score:81 alignment:4M1S[1,2]6M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VNWLAGETLAAN
>Combined_317 score:74 alignment:11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VNWVQETLAAN
>Combined_311 score:79 alignment:11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VNWVQQTLAAN
>Combined_1507 score:88 alignment:11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~MLCVGFLEGGK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1165_014 score:70 alignment:11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~T....L...D.....NNLTLLK.L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C178_024 score:76 alignment:2M1I9M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~K.LVS.SP.A..TLNSR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2710 score:85 alignment:3I11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ADLH.N.LDV...L......E.....G...NE....Q~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3520 score:70 alignment:11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~QVSLNSGS.HGF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C729_004 score:70 alignment:11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~F..N.G.N...T....L...D.....NDPV~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1377 score:83 alignment:11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VNWLQETLAAN
>Combined_3198 score:77 alignment:2I11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LAVNWVQQTLAAN
>Combined_3015 score:78 alignment:2M1S[2,2]7M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~MLAMGFLEGGK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C347_013 score:79 alignment:11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~E.....G...NE....QF.L.NAVK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1007 score:64 alignment:2M1S[2,1]7M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~FCNSLLNENW~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C239_011 score:76 alignment:9M1S[2,2] unique:True
~~~~~~~~~~~~~~~~~~~~SLPYQVSLNGS~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_159 score:88 alignment:11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~N...T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1776_002 score:85 alignment:3I11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KYEN.LDV...L......E.....G...NE....QF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1402 score:68 alignment:6M1S[2,2]2M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L.S.SP.A..TNLSR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C259_018 score:68 alignment:2M1S[2,2]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~T....L...N.....DDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_014 score:80 alignment:10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~T....L...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_043 score:75 alignment:10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~T....L...D.....DDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C206_021 score:68 alignment:2M1S[2,2]6M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLH.T..P...N.F..N.G.N~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C923_019 score:68 alignment:3M1S[2,2]5M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~T....L...D.....DNLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_068 score:75 alignment:10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L.S.SP.A..TLDSR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_066 score:80 alignment:10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~APVLSDSSCK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_002 score:80 alignment:10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L.S.SP.A..TLNSR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1108_008 score:68 alignment:2M1S[2,2]6M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SSSGS.YPSLL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_795 score:70 alignment:1I10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KLLQ.L.S.SP.A..TL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1616_004 score:68 alignment:5M1I5M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SSGSSGYPSLL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C751_012 score:80 alignment:10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~V...L......E.....G...NE....QF.L.N~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3013 score:70 alignment:1I10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TF.HFCGGSLLN~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1498 score:80 alignment:10M unique:True
~~~~~~~~~LVGGYTCAAN~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C908_009 score:71 alignment:10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~T....L...D.....NDLTLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C176_016 score:79 alignment:1I10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LL.S.SP.A..TLNSR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1120 score:80 alignment:10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~CGGSLLNSQW~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1367 score:78 alignment:2I10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~RWCGGSLLNSQW~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C392_020 score:73 alignment:2I10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~RLL.S.SP.A..TLDSR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2640 score:75 alignment:10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.H..P...N.F..D.G.N~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C53_008 score:79 alignment:1I10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~RL.S.SP.A..TLNSR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C506_005 score:68 alignment:3M1I7M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLTGH..P...N.F..N.G.N~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C875_002 score:70 alignment:1S[2,2]8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AVE.H.N.LDV...L......E~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1164_004 score:75 alignment:9M1S[1,2] unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~CGGSLLNSQMA~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1561_002 score:79 alignment:1I10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GSSGSS.YPSLL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C93_012 score:68 alignment:7M1S[2,2]1M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~APVLSDSCSK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2016 score:70 alignment:1I10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~WNVLQQTLAAN
>Combined_912 score:80 alignment:10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SSGSS.YPSLL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3463 score:75 alignment:10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~QVSLDSGS.HF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C501_004 score:78 alignment:2I10M unique:True
~~~~~~~~~~~~~~~~~~~~~~NRQVSLNSGS.HF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2499 score:71 alignment:10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~T....L...D.....NDLMLLR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2544 score:80 alignment:10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SSYPGQLT..GN~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C867_005 score:71 alignment:10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~NWVQQTLAAN
>Combined_976 score:70 alignment:1I10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~RLL.L.S.SP.A..TLN~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1058 score:66 alignment:10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~T....L...D.....DDLTLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C708_004 score:65 alignment:4M1S[2,2]4M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~T....L...D.....DEVMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_992 score:70 alignment:10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TTGSS.YPSLL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1401_002 score:68 alignment:4M1S[2,2]4M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SSGSY.SPSLL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_718 score:70 alignment:1I10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~QGVSLNSGS.HF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_810 score:80 alignment:10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LDV...L......E.....G...NE....QF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C608_003 score:68 alignment:2M1I8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SRDVATVSLPR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1460 score:70 alignment:2M1S[2,1]6M unique:True
~~~~~~~~~LVNYTCAAN~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C20_013 score:76 alignment:2I7M1S[1,2]2M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PSL.S.SP.A..TLGGSR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1817_011 score:75 alignment:10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DGQLQGLVSW~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1371_010 score:67 alignment:1I2M1S[2,2]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GSSSGS.YPSLL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C963_014 score:71 alignment:10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLR.L.S.SP.A..TL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3537 score:75 alignment:10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TSGSS.YPSLL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C3360 score:66 alignment:10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~CGGSLLNEDW~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1861_013 score:66 alignment:10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TSDSS.YPSLL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1589 score:73 alignment:2I10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VRL.T.SP.A..TLNSR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1502 score:70 alignment:6M1S[2,2]2M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L.S.SP.A..TQVSR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C987_007 score:60 alignment:2M1D7M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~N.G.....T....L...D.....NDLM~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3663 score:68 alignment:7M1S[2,2]1M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L.S.SP.A..TLSNR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2639 score:78 alignment:2I10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~RLL.S.SP.A..TLNSR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_722 score:66 alignment:10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~CGGSLLNENW~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1506 score:70 alignment:1I10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KGCS.YPSLLQC~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_760 score:80 alignment:10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.H..P...N.F..N.G.N~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_714 score:80 alignment:10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~QVSLNSGS.HF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_865 score:68 alignment:8M1S[2,2] unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L.S.SP.A..TLNRS~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C760_010 score:71 alignment:1I9M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~NL...D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1537_014 score:61 alignment:1I1S[2,1]7M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QNSLLNSQW~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1151 score:63 alignment:9M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LNE.H.N.LDV...L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1236_011 score:71 alignment:1I9M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QGGSLLNSQW~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C59_008 score:60 alignment:6M1S[2,2]1M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~S.SP.A..TLSNR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1086 score:60 alignment:7M1S[2,2] unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~S.SP.A..TLNRS~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_972 score:72 alignment:9M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~WLQQTLAAN
>Combined_781 score:62 alignment:1S[2,2]7M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AVE.H.N.LDV...L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C995 score:60 alignment:1S[2,2]7M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KTVCNYVNW~~~~~~~
>Combined_904 score:72 alignment:9M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LK.L.S.SP.A..TL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1050 score:72 alignment:9M unique:True
~~~~~~~~~~~~~~TCAAN.SLPY~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1948_005 score:60 alignment:3M1S[2,2]4M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GQLGQLVSW~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1131 score:60 alignment:1S[2,2]7M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QGLQGLVSW~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_042 score:63 alignment:9M unique:True
~~~~~~~~~~~~~~~~~~~~SVPYQVSLN~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1622_005 score:71 alignment:1I9M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ASGSS.YPSLL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1567_004 score:60 alignment:1S[2,2]7M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GSSS.YPSLL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2467 score:62 alignment:1S[2,2]7M unique:True
~~~~~~~~~~~~~~~~~~~~TVPYQVSLN~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_073 score:72 alignment:9M unique:True
~~~~~~~~~~~~~~~~~~~~SLPYQVSLN~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C135_004 score:63 alignment:9M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~K.APLLSDSS~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_736 score:66 alignment:1I9M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GS.SP.A..TLDSR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3656 score:67 alignment:1S[1,2]8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VA.VATVSLPR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2651 score:72 alignment:9M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LDV...L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C213_022 score:72 alignment:9M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SQW.VVSAAH~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_710 score:72 alignment:9M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~S.SP.A..TLNSR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C991_003 score:72 alignment:9M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~CGGSLLNSQ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3460 score:71 alignment:1I9M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GLGE.H.N.LDV...L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_409 score:63 alignment:9M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~WVQQTLAAN
>Combined_1122 score:66 alignment:1I9M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AEGSS.YPSLL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_320 score:63 alignment:9M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~T....L...D.....NDLTLL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1142_004 score:72 alignment:9M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TKVCNYVNW~~~~~~~
>Combined_008 score:64 alignment:8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.H..P...N.F..N~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_003 score:64 alignment:8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VATVSLPR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1366 score:63 alignment:1I8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~CGSLLNSQW~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C640_002 score:59 alignment:8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~SLDSGS.HF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C682_003 score:63 alignment:1I8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~NVATVSLPR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_712 score:64 alignment:8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LQQTLAAN
>C1093_008 score:64 alignment:8M unique:True
~~~~~~~~~~~~~~~~~~~~SLPYQVSL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2503 score:64 alignment:8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~T....L...D.....NDLML~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2504 score:64 alignment:8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~YVNWLQQT~~~
>C409_003 score:64 alignment:8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~K.L.S.SP.A..TL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_034 score:64 alignment:8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~E....QF.L.NAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_055 score:64 alignment:8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L.S.SP.A..TLN~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2163 score:64 alignment:8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VNWLQQTL~~
>C661_016 score:64 alignment:8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~D.....NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_765 score:59 alignment:8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.H..P...N.F..D~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1496 score:64 alignment:8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SP.A..TLNSR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C529_004 score:59 alignment:8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~K.L.T.SP.A..TL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C435_002 score:54 alignment:4M1S[2,1]2M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~S.HFCNSL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C284_005 score:63 alignment:1I8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GLQQTLAAN
>C266_006 score:63 alignment:1I8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GVVSAAHCY~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_863 score:64 alignment:8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VVSAAHCY~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_528 score:56 alignment:7M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~HFCGGSL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1479 score:56 alignment:7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~NDLMLLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C745_003 score:56 alignment:7M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLT.H..P...N.F~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2918 score:56 alignment:7M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGE.H.N.LD~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_861 score:56 alignment:7M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~P.A..TLNSR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1261 score:56 alignment:7M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VCNYVNW~~~~~~~

Template Sequence

FPTDDDDKIVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSRIQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSRVATVSLPRSCAAAGTECLISGWGNTKSSGSSYPSLLQCLKAPVLSDSSCKSSYPGQITGNMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCAQKNKPGVYTKVCNYVNWIQQTIAAN

Meta Information from fasta

Identifier

TRYP

Fasta header

sp|P00761|TRYP_PIG Trypsin OS=Sus scrofa OX=9823 PE=1 SV=1

Originating file

Decoy /storage/khangl/MS_benchmarking/stitch-v1.5.0-linux/templates/common_contaminants.fasta

Segment TRYP

Consensus Sequence

Annotated Consensus Sequence

Annotated Consensus Sequence (TXT)

Preview

Sequence Consensus Overview

Sequence Consensus Overview (TSV)

Preview

Variant Graph

Higher Order Variant Graph

Depth of Coverage of the Consensus Sequence?BargraphThe depth of coverage reported is the sum of all positional scores for that position. This is reported with the same position numbering as the consensus sequence.

Bargraph

Depth of Coverage of the Consensus Sequence (TSV)

Preview

Scores

Length

Score

Matches

Unique Score

Unique Matches

Alignment

Reads Alignment (FASTA)

Preview

Combined_002

Combined_003

Combined_008

Combined_037

Combined_046

Combined_015

Combined_047

Combined_057

C212

Combined_014

C219

C220

Combined_016

Combined_1426

Combined_051

Combined_017

Combined_018

C263

Combined_052

C289

Combined_1400

Combined_934

Combined_1431

Combined_061

C555

C80

C81

C130

C173

C184

C193

Combined_1440

C202

Combined_025

Combined_024

Combined_058

Combined_026

Combined_079

Combined_3883

Combined_027

Combined_028

Combined_160

Combined_2660

Combined_162

Combined_100

C437_002

Combined_029

Combined_062

Combined_030

Combined_103

C493

C537

C584

Combined_063

Combined_1452

Combined_1402

Combined_034

Depth of Coverage of the Consensus Sequence